Recombinant Human TLR1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related TLR1 Peptides and Proteins

Order Details


    • Catalog Number
      H00007096-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TLR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 321-420 of Human TLR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
TLR1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100 mM Tris, pH 8.0

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TLR1 Protein

  • CD281 antigen
  • CD281
  • DKFZp547I0610
  • DKFZp564I0682
  • KIAA0012MGC126311
  • MGC104956
  • MGC126312
  • rsc786
  • TIL
  • TIL. LPRS5
  • TLR1
  • Toll/interleukin-1 receptor-like protein
  • toll-like receptor 1

Background

TLR1 - toll-like receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56536
Species: Hu
Applications: Flow, IHC, IHC-P, Flow-CS, Flow-IC
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-24787
Species: Hu, Mu, Ca
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, Flow-CS, Flow-IC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
DDX0490P-100
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-24917
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC-P, CyTOF-ready, Flow-IC

Publications for TLR1 Partial Recombinant Protein (H00007096-Q01) (0)

There are no publications for TLR1 Partial Recombinant Protein (H00007096-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLR1 Partial Recombinant Protein (H00007096-Q01) (0)

There are no reviews for TLR1 Partial Recombinant Protein (H00007096-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TLR1 Partial Recombinant Protein (H00007096-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TLR1 Products

Bioinformatics Tool for TLR1 Partial Recombinant Protein (H00007096-Q01)

Discover related pathways, diseases and genes to TLR1 Partial Recombinant Protein (H00007096-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TLR1 Partial Recombinant Protein (H00007096-Q01)

Discover more about diseases related to TLR1 Partial Recombinant Protein (H00007096-Q01).
 

Pathways for TLR1 Partial Recombinant Protein (H00007096-Q01)

View related products by pathway.

PTMs for TLR1 Partial Recombinant Protein (H00007096-Q01)

Learn more about PTMs related to TLR1 Partial Recombinant Protein (H00007096-Q01).
 

Research Areas for TLR1 Partial Recombinant Protein (H00007096-Q01)

Find related products by research area.

Blogs on TLR1.

The role of STING/TMEM173 in gamma and encephalitis Herpes Simplex Virus (HSV)
Stimulator of interferon genes (STING), also known as TMEM173, promotes the production of the interferon’s IFN-alpha and IFN-beta.  STING possesses three functional domains: a cytoplasmic C-terminal tail, a central globular domain, and four N-...  Read full blog post.

TLR1
TLR1 belongs to the Toll-like receptor (TLR) family, and is a key player in the recognition of pathogens as well as the activation of the innate immunity system. TLRs are highly conserved proteins with a high degree of structural and functional homolo...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TLR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TLR1
Entrez