TLK2 Antibody (2G7) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related TLK2 Primary Antibodies

Order Details


    • Catalog Number
      H00011011-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TLK2 Antibody (2G7) [PerCP] Summary

Immunogen
TLK2 (AAH44925, 1 a.a. ~ 126 a.a) partial recombinant protein with GST tag.MEELHSLDPRRQELLEARFTGVGVSKGPLNSESSNQSLCSVG SLSDKEVETPEKKQNDQRNRKRKAEPYETSQGKGTPRGHKIS DYFEFAGGSAPGTSPGRSVPPVARSSPQHSLSNPLPRRVEQP
Localization
Nuclear
Specificity
TLK2 - tousled-like kinase 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TLK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TLK2 Antibody (2G7) [PerCP]

  • EC 2.7.11
  • EC 2.7.11.1
  • MGC44450
  • PKU-ALPHA
  • serine/threonine-protein kinase tousled-like 2
  • tousled-like kinase 2serine/threonine kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57608
Species: Hu
Applications: WB, ICC/IF
H00055723-M03
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-201
Species: Hu, Mu, Rt, Po, Bv, Ca, Fi, Rb, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA
NBP2-20053
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP1-46170
Species: Hu
Applications: WB, IHC-P, IP
NB100-41418
Species: Hu
Applications: WB, IHC-P, IP
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87390
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-80628
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86649
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56355
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-188
Species: Rt
Applications: IHC, IHC-P
H00011011-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TLK2 Antibody (H00011011-M01PCP) (0)

There are no publications for TLK2 Antibody (H00011011-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TLK2 Antibody (H00011011-M01PCP) (0)

There are no reviews for TLK2 Antibody (H00011011-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TLK2 Antibody (H00011011-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TLK2 Products

Bioinformatics Tool for TLK2 Antibody (H00011011-M01PCP)

Discover related pathways, diseases and genes to TLK2 Antibody (H00011011-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TLK2 Antibody (H00011011-M01PCP)

Discover more about diseases related to TLK2 Antibody (H00011011-M01PCP).
 

Pathways for TLK2 Antibody (H00011011-M01PCP)

View related products by pathway.

PTMs for TLK2 Antibody (H00011011-M01PCP)

Learn more about PTMs related to TLK2 Antibody (H00011011-M01PCP).
 

Research Areas for TLK2 Antibody (H00011011-M01PCP)

Find related products by research area.

Blogs on TLK2

There are no specific blogs for TLK2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TLK2 Antibody (2G7) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol TLK2