TKTL1 Antibody (1C10) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related TKTL1 Primary Antibodies

Order Details


    • Catalog Number
      H00008277-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TKTL1 Antibody (1C10) [DyLight 405] Summary

Immunogen
TKTL1 (AAH25382, 1 a.a. ~ 597 a.a) full length recombinant protein with GST tag.MADAEARAEFPEEARPDRGTLQVFQDMASRLRIHSIRATCST SSGHPTSCSSSSEIMSVLFFYIMRYKQSDPENPDNDRFVLAK RLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSD GESSEGSVWEAMAFASYYSLDNLVATFDVNRLGHSGALPAEH CINIYQRRCEAFGWNTYVVDGRDVEALCQVFWQASQVKHKPT AVVAKTFKGRGTPSIEDAESWHAKPMPRERADAII
Localization
Cytoplasmic and Nuclear. Note=Predominantly cytoplasmic and to a lesser extent also nuclear.
Specificity
TKTL1 - transketolase-like 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TKTL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 405
Format
DyLight 405 (A=400, E=420)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It is also useful for immunofluorescence.

Reactivity Notes

Human. Other species not tested.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TKTL1 Antibody (1C10) [DyLight 405]

  • TK 2
  • TKREC 2.2.1.1
  • TKT2Transketolase 2
  • transketolase-2
  • transketolase-like 1
  • transketolase-like protein 1
  • Transketolase-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25382
Species: Hu
Applications: WB, Simple Western
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2055
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC, ICFlow
NB100-91717
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006448-B01P
Species: Hu
Applications: WB, ELISA
NBP1-90187
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02677
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-2357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB8967
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-20650
Species: Hu, Mu
Applications: WB
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TKTL1 Antibody (H00008277-M01V) (0)

There are no publications for TKTL1 Antibody (H00008277-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TKTL1 Antibody (H00008277-M01V) (0)

There are no reviews for TKTL1 Antibody (H00008277-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TKTL1 Antibody (H00008277-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TKTL1 Antibody (1C10) [DyLight 405] Products

Related Products by Gene

Bioinformatics Tool for TKTL1 Antibody (H00008277-M01V)

Discover related pathways, diseases and genes to TKTL1 Antibody (H00008277-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TKTL1 Antibody (H00008277-M01V)

Discover more about diseases related to TKTL1 Antibody (H00008277-M01V).
 

Pathways for TKTL1 Antibody (H00008277-M01V)

View related products by pathway.

PTMs for TKTL1 Antibody (H00008277-M01V)

Learn more about PTMs related to TKTL1 Antibody (H00008277-M01V).

Blogs on TKTL1

There are no specific blogs for TKTL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TKTL1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00008277-M01V below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.