TIN2 Antibody

Images

 
Western Blot: TIN2 Antibody [NBP1-54837] - MCF7, Antibody Dilution: 1.0 ug/ml TINF2 is supported by BioGPS gene expression data to be expressed in MCF7.
Western Blot: TIN2 Antibody [NBP1-54837] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIN2 Antibody Summary

Immunogen
Synthetic peptides corresponding to TIN2. The peptide sequence was selected from the middle region of TIN2. Peptide sequence SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TINF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TINF2 and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 3
using
NBP1-54837 in the following application:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TIN2 Antibody

  • (TRF1)-interacting nuclear factor 2 variant 1
  • TERF1 (TRF1)-interacting nuclear factor 2
  • TERF1-interacting nuclear factor 2
  • TIN2TRF1-interacting nuclear protein 2

Background

TINF2(TIN2) is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-176
Species: Hu
Applications: WB
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14870
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-86307
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85156
Species: Hu
Applications: WB, IHC, IHC-P
NB100-186
Species: Hu
Applications: WB, ICC/IF
NBP2-32441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13656
Species: Hu
Applications: WB, IHC, IHC-P
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-22360
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90029
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54837
Species: Hu
Applications: WB

Publications for TIN2 Antibody (NBP1-54837) (0)

There are no publications for TIN2 Antibody (NBP1-54837).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TIN2 Antibody (NBP1-54837) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-54837:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TIN2 NBP1-54837
Enlarge
reviewed by:
Anonymous
WB Human 03/07/2016
View

Summary

ApplicationWestern Blot
Sample TestedLung cell line extracts
SpeciesHuman
LotQC24521-90324

Blocking

Blocking Details1 hr using 5% milk at room temperature

Primary Anitbody

Dilution Ratio1:1000

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#1706515
Secondary Concentration1:10,000

Details

Detection NotesECL based detection using Chemidoc MP, 2 minutes.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIN2 Antibody (NBP1-54837) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIN2 Products

Bioinformatics Tool for TIN2 Antibody (NBP1-54837)

Discover related pathways, diseases and genes to TIN2 Antibody (NBP1-54837). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIN2 Antibody (NBP1-54837)

Discover more about diseases related to TIN2 Antibody (NBP1-54837).
 

Pathways for TIN2 Antibody (NBP1-54837)

View related products by pathway.

PTMs for TIN2 Antibody (NBP1-54837)

Learn more about PTMs related to TIN2 Antibody (NBP1-54837).

Blogs on TIN2

There are no specific blogs for TIN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
03/07/2016
Application: WB
Species: Human

Bioinformatics

Gene Symbol TINF2
Uniprot