Recombinant Human TIMP-3 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related TIMP-3 Peptides and Proteins

Order Details


    • Catalog Number
      H00007078-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TIMP-3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 112-211 of Human TIMP3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TIMP3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TIMP-3 Protein

  • HSMRK222
  • K222
  • K222TA2
  • metalloproteinase inhibitor 3
  • MIG-5 protein
  • Protein MIG-5
  • pseudoinflammatory)
  • SFD
  • TIMP metallopeptidase inhibitor 3
  • TIMP3
  • TIMP-3
  • tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy
  • Tissue inhibitor of metalloproteinases 3

Background

TIMP3 - tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
930-ADB
Species: Hu
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P

Publications for TIMP-3 Partial Recombinant Protein (H00007078-Q01) (0)

There are no publications for TIMP-3 Partial Recombinant Protein (H00007078-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMP-3 Partial Recombinant Protein (H00007078-Q01) (0)

There are no reviews for TIMP-3 Partial Recombinant Protein (H00007078-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIMP-3 Partial Recombinant Protein (H00007078-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIMP-3 Products

Bioinformatics Tool for TIMP-3 Partial Recombinant Protein (H00007078-Q01)

Discover related pathways, diseases and genes to TIMP-3 Partial Recombinant Protein (H00007078-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMP-3 Partial Recombinant Protein (H00007078-Q01)

Discover more about diseases related to TIMP-3 Partial Recombinant Protein (H00007078-Q01).
 

Pathways for TIMP-3 Partial Recombinant Protein (H00007078-Q01)

View related products by pathway.

PTMs for TIMP-3 Partial Recombinant Protein (H00007078-Q01)

Learn more about PTMs related to TIMP-3 Partial Recombinant Protein (H00007078-Q01).
 

Research Areas for TIMP-3 Partial Recombinant Protein (H00007078-Q01)

Find related products by research area.

Blogs on TIMP-3

There are no specific blogs for TIMP-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TIMP-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMP3
Entrez