TIMP-2 Antibody (4F5)

Images

 
Immunocytochemistry/ Immunofluorescence: TIMP-2 Antibody (4F5) [H00007077-M02J] - TIMP2 (H00007077-M02J) on HeLa cell. [antibody concentration 10 ug/ml]

Product Details

Summary
Product Discontinued
View other related TIMP-2 Primary Antibodies

Order Details


    • Catalog Number
      H00007077-M02J
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TIMP-2 Antibody (4F5) Summary

Immunogen
TIMP2 (AAH52605, 27 a.a. - 220 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Specificity
TIMP metallopeptidase inhibitor 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TIMP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMP-2 Antibody (4F5)

  • CSC-21Ktissue inhibitor of metalloproteinase 2
  • metalloproteinase inhibitor 2
  • TIMP metallopeptidase inhibitor 2
  • TIMP2
  • TIMP-2
  • Tissue inhibitor of metalloproteinases 2

Background

This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TIMP-2 Antibody (H00007077-M02J) (0)

There are no publications for TIMP-2 Antibody (H00007077-M02J).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMP-2 Antibody (H00007077-M02J) (0)

There are no reviews for TIMP-2 Antibody (H00007077-M02J). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIMP-2 Antibody (H00007077-M02J) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIMP-2 Products

Bioinformatics Tool for TIMP-2 Antibody (H00007077-M02J)

Discover related pathways, diseases and genes to TIMP-2 Antibody (H00007077-M02J). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMP-2 Antibody (H00007077-M02J)

Discover more about diseases related to TIMP-2 Antibody (H00007077-M02J).
 

Pathways for TIMP-2 Antibody (H00007077-M02J)

View related products by pathway.

PTMs for TIMP-2 Antibody (H00007077-M02J)

Learn more about PTMs related to TIMP-2 Antibody (H00007077-M02J).
 

Research Areas for TIMP-2 Antibody (H00007077-M02J)

Find related products by research area.

Blogs on TIMP-2

There are no specific blogs for TIMP-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMP-2 Antibody (4F5) and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMP2
Entrez
OMIM
Uniprot