TIMP-2 Antibody (1C3)

Images

 
Western Blot: TIMP-2 Antibody (1C3) [H00007077-M03] - Analysis of TIMP2 expression in HeLa (Cat # L013V1).
Immunocytochemistry/ Immunofluorescence: TIMP-2 Antibody (1C3) [H00007077-M03] - Analysis of monoclonal antibody to TIMP2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: TIMP-2 Antibody (1C3) [H00007077-M03] - Analysis of monoclonal antibody to TIMP2 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml
Sandwich ELISA: TIMP-2 Antibody (1C3) [H00007077-M03] - Detection limit for recombinant GST tagged TIMP2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TIMP-2 Antibody (1C3) Summary

Immunogen
TIMP2 (AAH52605, 27 a.a. - 220 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Specificity
This product is specific for Human TIMP2 monoclonal antibody (M03), clone 1C3 [Gene ID: 7077].
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TIMP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMP-2 Antibody (1C3)

  • CSC-21Ktissue inhibitor of metalloproteinase 2
  • metalloproteinase inhibitor 2
  • TIMP metallopeptidase inhibitor 2
  • TIMP2
  • TIMP-2
  • Tissue inhibitor of metalloproteinases 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TIMP-2 Antibody (H00007077-M03) (0)

There are no publications for TIMP-2 Antibody (H00007077-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMP-2 Antibody (H00007077-M03) (0)

There are no reviews for TIMP-2 Antibody (H00007077-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIMP-2 Antibody (H00007077-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIMP-2 Products

Bioinformatics Tool for TIMP-2 Antibody (H00007077-M03)

Discover related pathways, diseases and genes to TIMP-2 Antibody (H00007077-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMP-2 Antibody (H00007077-M03)

Discover more about diseases related to TIMP-2 Antibody (H00007077-M03).
 

Pathways for TIMP-2 Antibody (H00007077-M03)

View related products by pathway.

PTMs for TIMP-2 Antibody (H00007077-M03)

Learn more about PTMs related to TIMP-2 Antibody (H00007077-M03).
 

Research Areas for TIMP-2 Antibody (H00007077-M03)

Find related products by research area.

Blogs on TIMP-2

There are no specific blogs for TIMP-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMP-2 Antibody (1C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMP2
Entrez
Uniprot