TIM-3 Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related TIM-3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69398
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TIM-3 Antibody Summary

Immunogen
Synthetic peptides corresponding to HAVCR2(hepatitis A virus cellular receptor 2) The peptide sequence was selected from the N terminal of HAVCR2. Peptide sequence MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP.
Clonality
Polyclonal
Host
Rabbit
Gene
HAVCR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This is a rabbit polyclonal antibody against HAVCR2 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TIM-3 Antibody

  • CD366
  • FLJ14428
  • HAVCR2
  • HAVcr-2
  • hepatitis A virus cellular receptor 2
  • kidney injury molecule-3
  • T cell immunoglobulin mucin 3
  • T cell immunoglobulin mucin-3
  • T-cell immunoglobulin and mucin domain-containing protein 3
  • TIM 3
  • TIM3 T-cell membrane protein 3
  • TIM3
  • TIM-3
  • TIMD-3
  • TIMD3KIM-3

Background

HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. HAVCR2 is the receptor for LGALS9.CD4 (MIM 186940)-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells and their associated cytokines are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. The 2 types of cells also cross-regulate the functions of the other. TIM3 is a Th1-specific cell surface protein that regulates macrophage activation and enhances the severity of experimental autoimmune encephalomyelitis in mice.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-562 BC063431.1 1-562 563-1203 AF450243.1 476-1116 1204-2338 BC063431.1 1204-2338

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2045
Species: Hu
Applications: WB, IHC, ICC
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-40853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB7158
Species: Hu, Mu
Applications: WB, IHC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for TIM-3 Antibody (NBP1-69398) (0)

There are no publications for TIM-3 Antibody (NBP1-69398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIM-3 Antibody (NBP1-69398) (0)

There are no reviews for TIM-3 Antibody (NBP1-69398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIM-3 Antibody (NBP1-69398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIM-3 Products

Bioinformatics Tool for TIM-3 Antibody (NBP1-69398)

Discover related pathways, diseases and genes to TIM-3 Antibody (NBP1-69398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIM-3 Antibody (NBP1-69398)

Discover more about diseases related to TIM-3 Antibody (NBP1-69398).
 

Pathways for TIM-3 Antibody (NBP1-69398)

View related products by pathway.

PTMs for TIM-3 Antibody (NBP1-69398)

Learn more about PTMs related to TIM-3 Antibody (NBP1-69398).
 

Research Areas for TIM-3 Antibody (NBP1-69398)

Find related products by research area.

Blogs on TIM-3.

TIM-3, a critical immune checkpoint in HIV research
CD4+ T-helper cells (Th) are the white blood lymphocytes expressing surface glycoprotein antigen CD4. These T-helper cells play an important role in the adaptive immune system by releasing T cell cytokines that help other immune cells to suppress o...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIM-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAVCR2
Entrez
Uniprot