TIM-3 Antibody



Product Details

Product Discontinued
View other related TIM-3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TIM-3 Antibody Summary

Synthetic peptides corresponding to HAVCR2(hepatitis A virus cellular receptor 2) The peptide sequence was selected from the N terminal of HAVCR2. Peptide sequence MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against HAVCR2 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
33 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing. HAVCR2 is the receptor for LGALS9.CD4 (MIM 186940)-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells and their associated cytokines are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. The 2 types of cells also cross-regulate the functions of the other. TIM3 is a Th1-specific cell surface protein that regulates macrophage activation and enhances the severity of experimental autoimmune encephalomyelitis in mice.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-562 BC063431.1 1-562 563-1203 AF450243.1 476-1116 1204-2338 BC063431.1 1204-2338


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: Flow, IHC, ICC
Species: Hu
Applications: WB
Species: Hu, I
Applications: WB

Publications for TIM-3 Antibody (NBP1-69398) (0)

There are no publications for TIM-3 Antibody (NBP1-69398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIM-3 Antibody (NBP1-69398) (0)

There are no reviews for TIM-3 Antibody (NBP1-69398). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for TIM-3 Antibody (NBP1-69398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIM-3 Antibody Products

Related Products by Gene

Bioinformatics Tool for TIM-3 Antibody (NBP1-69398)

Discover related pathways, diseases and genes to TIM-3 Antibody (NBP1-69398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIM-3 Antibody (NBP1-69398)

Discover more about diseases related to TIM-3 Antibody (NBP1-69398).

Pathways for TIM-3 Antibody (NBP1-69398)

View related products by pathway.

PTMs for TIM-3 Antibody (NBP1-69398)

Learn more about PTMs related to TIM-3 Antibody (NBP1-69398).

Blogs on TIM-3.

TIM-3, a critical immune checkpoint in HIV research
CD4+ T-helper cells (Th) are the white blood lymphocytes expressing surface glycoprotein antigen CD4. These T-helper cells play an important role in the adaptive immune system by releasing T cell cytokines that help other immune cells to suppress o...  Read full blog post.

Contact Information

Product PDFs


Gene Symbol HAVCR2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69398 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.