TIM-1/KIM-1/HAVCR Antibody


Western Blot: TIM-1 Antibody [NBP1-69350] - This Anti-HAVCR1 antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related TIM-1/KIM-1/HAVCR Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TIM-1/KIM-1/HAVCR Antibody Summary

Synthetic peptides corresponding to HAVCR1(hepatitis A virus cellular receptor 1) The peptide sequence was selected from the N terminal of HAVCR1. Peptide sequence CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HAVCR1 and was validated on Western blot.
Theoretical MW
39 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TIM-1/KIM-1/HAVCR Antibody

  • CD365
  • HAVCR1
  • HAVCR-1
  • HAVCRT cell immunoglobin domain and mucin domain protein 1
  • hepatitis A virus cellular receptor 1
  • Kidney injury molecule 1
  • KIM1
  • KIM-1
  • T-cell immunoglobulin and mucin domain-containing protein 1
  • TIM1
  • TIM-1
  • TIM-1TIM
  • TIM1TIMD-1
  • TIMD1T-cell membrane protein 1


HAVCR1 may play a role in T-helper cell development and the regulation of asthma and allergic diseases. HAVCR1 is the receptor for TIMD4. In case of human hepatitis A virus (HHAV) infection, it functions as a cell-surface receptor for the virus.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Simple Western, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TIM-1/KIM-1/HAVCR Antibody (NBP1-69350) (0)

There are no publications for TIM-1/KIM-1/HAVCR Antibody (NBP1-69350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIM-1/KIM-1/HAVCR Antibody (NBP1-69350) (0)

There are no reviews for TIM-1/KIM-1/HAVCR Antibody (NBP1-69350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIM-1/KIM-1/HAVCR Antibody (NBP1-69350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TIM-1/KIM-1/HAVCR Products

Bioinformatics Tool for TIM-1/KIM-1/HAVCR Antibody (NBP1-69350)

Discover related pathways, diseases and genes to TIM-1/KIM-1/HAVCR Antibody (NBP1-69350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIM-1/KIM-1/HAVCR Antibody (NBP1-69350)

Discover more about diseases related to TIM-1/KIM-1/HAVCR Antibody (NBP1-69350).

Pathways for TIM-1/KIM-1/HAVCR Antibody (NBP1-69350)

View related products by pathway.

PTMs for TIM-1/KIM-1/HAVCR Antibody (NBP1-69350)

Learn more about PTMs related to TIM-1/KIM-1/HAVCR Antibody (NBP1-69350).

Blogs on TIM-1/KIM-1/HAVCR

There are no specific blogs for TIM-1/KIM-1/HAVCR, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TIM-1/KIM-1/HAVCR Antibody and receive a gift card or discount.


Gene Symbol HAVCR1