TIGD5 Antibody

Images

 
Western Blot: TIGD5 Antibody [NBP3-09640] - Western blot analysis of TIGD5 in Mouse Liver lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIGD5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse TIGD5 (NP_848761). Peptide sequence PGSTARPPPPPAPGPRPRVAVKMTFRKAYSIKDKLQAIERVKGGERQASV
Clonality
Polyclonal
Host
Rabbit
Gene
TIGD5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for TIGD5 Antibody

  • tigger transposable element derived 5
  • tigger transposable element-derived protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33422
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, KD, KO
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-80426
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-91926
Species: Hu
Applications: IHC, IHC-P
NBP1-87243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33648
Species: Hu
Applications: IHC, IHC-P
NBP1-03341
Species: Hu
Applications: WB, IP

Publications for TIGD5 Antibody (NBP3-09640) (0)

There are no publications for TIGD5 Antibody (NBP3-09640).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIGD5 Antibody (NBP3-09640) (0)

There are no reviews for TIGD5 Antibody (NBP3-09640). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIGD5 Antibody (NBP3-09640) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TIGD5 Products

Array NBP3-09640

Bioinformatics Tool for TIGD5 Antibody (NBP3-09640)

Discover related pathways, diseases and genes to TIGD5 Antibody (NBP3-09640). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIGD5 Antibody (NBP3-09640)

Discover more about diseases related to TIGD5 Antibody (NBP3-09640).

Blogs on TIGD5

There are no specific blogs for TIGD5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIGD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIGD5