TIF1 alpha Antibody (2F2) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related TIF1 alpha Primary Antibodies

Order Details


    • Catalog Number
      H00008805-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TIF1 alpha Antibody (2F2) [PE] Summary

Immunogen
TRIM24 (AAH28689 432 a.a. - 569 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW
Specificity
TRIM24 - tripartite motif-containing 24
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM24
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIF1 alpha Antibody (2F2) [PE]

  • E3 ubiquitin-protein ligase TRIM24
  • EC 6.3.2
  • EC 6.3.2.-
  • hTIF1
  • PTC6
  • RING finger protein 82
  • RNF82Tif1a
  • TIF1-alpha
  • TIF1ATIF1ALPHA
  • TIF1TF1A
  • transcription intermediary factor 1-alpha
  • transcriptional intermediary factor 1
  • tripartite motif containing 24
  • tripartite motif-containing 24
  • Tripartite motif-containing protein 24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051592-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00023316-M03
Species: Hu
Applications: WB, ELISA
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00008805-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for TIF1 alpha Antibody (H00008805-M01PE) (0)

There are no publications for TIF1 alpha Antibody (H00008805-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIF1 alpha Antibody (H00008805-M01PE) (0)

There are no reviews for TIF1 alpha Antibody (H00008805-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIF1 alpha Antibody (H00008805-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIF1 alpha Products

Bioinformatics Tool for TIF1 alpha Antibody (H00008805-M01PE)

Discover related pathways, diseases and genes to TIF1 alpha Antibody (H00008805-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIF1 alpha Antibody (H00008805-M01PE)

Discover more about diseases related to TIF1 alpha Antibody (H00008805-M01PE).
 

Pathways for TIF1 alpha Antibody (H00008805-M01PE)

View related products by pathway.

PTMs for TIF1 alpha Antibody (H00008805-M01PE)

Learn more about PTMs related to TIF1 alpha Antibody (H00008805-M01PE).
 

Research Areas for TIF1 alpha Antibody (H00008805-M01PE)

Find related products by research area.

Blogs on TIF1 alpha

There are no specific blogs for TIF1 alpha, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIF1 alpha Antibody (2F2) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM24