Tie-2 Antibody (3A5)

Images

 
Western Blot: Tie-2 Antibody (3A5) [H00007010-M20] - Analysis of TEK expression in Jurkat. (~145kD)
Western Blot: Tie-2 Antibody (3A5) [H00007010-M20] - Analysis of TEK expression in PC-12 (Cat # L012V1).
Western Blot: Tie-2 Antibody (3A5) [H00007010-M20] - Analysis of TEK expression in Raw 264.7 (Cat # L024V1).
Western Blot: Tie-2 Antibody (3A5) [H00007010-M20] - Analysis of TEK expression in NIH/3T3 (Cat # L018V1).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
3A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Tie-2 Antibody (3A5) Summary

Immunogen
TEK (NP_000450, 66 a.a. - 185 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQD*
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TEK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tie-2 Antibody (3A5)

  • angiopoietin-1 receptor
  • CD202b antigen
  • CD202b
  • EC 2.7.10
  • EC 2.7.10.1
  • hTIE2
  • p140 TEK
  • soluble TIE2 variant 1
  • soluble TIE2 variant 2
  • TEK tyrosine kinase, endothelial
  • TEK
  • Tie2
  • Tie-2
  • TIE2CD202b
  • Tunica interna endothelial cell kinase
  • Tyrosine-protein kinase receptor TEK
  • Tyrosine-protein kinase receptor TIE-2
  • venous malformations, multiple cutaneous and mucosal
  • VMCM
  • VMCM1

Background

The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF619
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF619
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for Tie-2 Antibody (H00007010-M20) (0)

There are no publications for Tie-2 Antibody (H00007010-M20).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tie-2 Antibody (H00007010-M20) (0)

There are no reviews for Tie-2 Antibody (H00007010-M20). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tie-2 Antibody (H00007010-M20) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tie-2 Products

Bioinformatics Tool for Tie-2 Antibody (H00007010-M20)

Discover related pathways, diseases and genes to Tie-2 Antibody (H00007010-M20). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tie-2 Antibody (H00007010-M20)

Discover more about diseases related to Tie-2 Antibody (H00007010-M20).
 

Pathways for Tie-2 Antibody (H00007010-M20)

View related products by pathway.

PTMs for Tie-2 Antibody (H00007010-M20)

Learn more about PTMs related to Tie-2 Antibody (H00007010-M20).
 

Research Areas for Tie-2 Antibody (H00007010-M20)

Find related products by research area.

Blogs on Tie-2

There are no specific blogs for Tie-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tie-2 Antibody (3A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol TEK
Entrez
Uniprot