TICRR Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TICRR Antibody [NBP2-58491] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TICRR Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPSE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TICRR
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TICRR Recombinant Protein Antigen (NBP2-58491PEP)

Reactivity Notes

Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TICRR Antibody

  • C15orf42
  • Chromosome 15 Open Reading Frame 42
  • SLD3 Homolog (S. Cerevisiae)
  • SLD3 Homolog
  • SLD3
  • TOPBP1-Interacting Checkpoint And Replication Regulator
  • TOPBP1-Interacting Replication-Stimulating Protein
  • TopBP1-Interacting, Replication-Stimulating Protein
  • Treslin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67897
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-217
Species: Hu, Mu
Applications: WB, IP
NB100-56546
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76922
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32708
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-35324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00004176-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NB100-404
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP2-41131
Species: Hu, Mu
Applications: WB, ELISA
NBP2-47310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00776
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-288
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-464
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67760
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-33825
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-58491
Species: Hu
Applications: ICC/IF

Publications for TICRR Antibody (NBP2-58491) (0)

There are no publications for TICRR Antibody (NBP2-58491).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TICRR Antibody (NBP2-58491) (0)

There are no reviews for TICRR Antibody (NBP2-58491). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TICRR Antibody (NBP2-58491) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TICRR Products

Array NBP2-58491

Bioinformatics Tool for TICRR Antibody (NBP2-58491)

Discover related pathways, diseases and genes to TICRR Antibody (NBP2-58491). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TICRR Antibody (NBP2-58491)

Discover more about diseases related to TICRR Antibody (NBP2-58491).
 

Pathways for TICRR Antibody (NBP2-58491)

View related products by pathway.

PTMs for TICRR Antibody (NBP2-58491)

Learn more about PTMs related to TICRR Antibody (NBP2-58491).

Blogs on TICRR

There are no specific blogs for TICRR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TICRR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TICRR