Thyrotropin Releasing Hormone Antibody

Images

 
Western Blot: Thyrotropin Releasing Hormone Antibody [NBP1-87427] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP1-87427] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Order Details


    • Catalog Number
      NBP1-87427
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Thyrotropin Releasing Hormone Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:REEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Thyrotropin Releasing Hormone Antibody

  • MGC125964
  • MGC125965
  • prothyroliberin
  • thyrotropin-releasing hormone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22444
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-87427
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Thyrotropin Releasing Hormone Antibody (NBP1-87427) (0)

There are no publications for Thyrotropin Releasing Hormone Antibody (NBP1-87427).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thyrotropin Releasing Hormone Antibody (NBP1-87427) (0)

There are no reviews for Thyrotropin Releasing Hormone Antibody (NBP1-87427). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Thyrotropin Releasing Hormone Antibody (NBP1-87427) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thyrotropin Releasing Hormone Products

Bioinformatics Tool for Thyrotropin Releasing Hormone Antibody (NBP1-87427)

Discover related pathways, diseases and genes to Thyrotropin Releasing Hormone Antibody (NBP1-87427). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thyrotropin Releasing Hormone Antibody (NBP1-87427)

Discover more about diseases related to Thyrotropin Releasing Hormone Antibody (NBP1-87427).
 

Pathways for Thyrotropin Releasing Hormone Antibody (NBP1-87427)

View related products by pathway.

PTMs for Thyrotropin Releasing Hormone Antibody (NBP1-87427)

Learn more about PTMs related to Thyrotropin Releasing Hormone Antibody (NBP1-87427).
 

Research Areas for Thyrotropin Releasing Hormone Antibody (NBP1-87427)

Find related products by research area.

Blogs on Thyrotropin Releasing Hormone

There are no specific blogs for Thyrotropin Releasing Hormone, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thyrotropin Releasing Hormone Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRH