Recombinant Human Thyroid receptor-interacting protein 11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Thyroid receptor-interacting protein 11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1756-1855 of Human TRIP11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LRQEMLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSILGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIP11
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Thyroid receptor-interacting protein 11 Protein

  • CEV14TR-interacting protein 11
  • Clonal evolution-related gene on chromosome 14 protein
  • GMAP-210ACG1A
  • Golgi-associated microtubule-binding protein 210
  • Golgi-microtubule-associated protein of 210 kDa
  • thyroid hormone receptor interactor 11
  • thyroid receptor-interacting protein 11
  • TRIP-11
  • Trip230

Background

TRIP11 was first identified through its ability to interact functionally with thyroid hormone receptor-beta (THRB; MIM 190160). It has also been found in association with the Golgi apparatus and microtubules.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88842
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00513
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-53420
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86245
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00055746-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC

Publications for Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01) (0)

There are no publications for Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01) (0)

There are no reviews for Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thyroid receptor-interacting protein 11 Products

Bioinformatics Tool for Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01)

Discover related pathways, diseases and genes to Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01)

Discover more about diseases related to Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01).
 

Pathways for Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01)

View related products by pathway.

PTMs for Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01)

Learn more about PTMs related to Thyroid receptor-interacting protein 11 Partial Recombinant Protein (H00009321-Q01).

Blogs on Thyroid receptor-interacting protein 11

There are no specific blogs for Thyroid receptor-interacting protein 11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Thyroid receptor-interacting protein 11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIP11