Thyroglobulin Antibody (1G3) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related Thyroglobulin Primary Antibodies

Order Details


    • Catalog Number
      H00007038-M01FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Thyroglobulin Antibody (1G3) [DyLight 680] Summary

Immunogen
TG (NP_003226 2659 a.a. - 2768 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK
Specificity
TG - thyroglobulin
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Thyroglobulin Antibody (1G3) [DyLight 680]

  • AITD3
  • AITD3TGN
  • cog
  • TDH3
  • Tg
  • TGN
  • Thyroglobulin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2009
Species: Hu
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Thyroglobulin Antibody (H00007038-M01FR) (0)

There are no publications for Thyroglobulin Antibody (H00007038-M01FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thyroglobulin Antibody (H00007038-M01FR) (0)

There are no reviews for Thyroglobulin Antibody (H00007038-M01FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Thyroglobulin Antibody (H00007038-M01FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thyroglobulin Products

Bioinformatics Tool for Thyroglobulin Antibody (H00007038-M01FR)

Discover related pathways, diseases and genes to Thyroglobulin Antibody (H00007038-M01FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thyroglobulin Antibody (H00007038-M01FR)

Discover more about diseases related to Thyroglobulin Antibody (H00007038-M01FR).
 

Pathways for Thyroglobulin Antibody (H00007038-M01FR)

View related products by pathway.

PTMs for Thyroglobulin Antibody (H00007038-M01FR)

Learn more about PTMs related to Thyroglobulin Antibody (H00007038-M01FR).
 

Research Areas for Thyroglobulin Antibody (H00007038-M01FR)

Find related products by research area.

Blogs on Thyroglobulin.

TTF1 / NKX2.1 - An essential regulator of lung development with implications in cancer diagnostics
Thyroid transcription factor 1 (TTF-1), also known as NKX2.1, is a conserved master regulatory transcription factor involved in the development of the lung, brain, and thyroid (1). In the lung TTF-1 positively regulates the expression of several lu...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thyroglobulin Antibody (1G3) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol TG
Entrez