Thrombospondin-3 Antibody

Images

 
Immunohistochemistry-Paraffin: THBS3 Antibody [NBP1-86131] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Thrombospondin-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TVGESRQMVAVAEKIRTALLTAGDIYLLSTFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADGRTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THBS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Thrombospondin-3 Protein (NBP1-86131PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Thrombospondin-3 Antibody

  • MGC119565
  • THBS3
  • thrombospondin 3
  • Thrombospondin3
  • Thrombospondin-3
  • TSP3
  • TSP3MGC119564

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
24420002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2390
Species: Hu
Applications: WB, Simple Western
NBP2-24582
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-85452
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
AF8216
Species: Hu, Mu, Rt
Applications: WB
AF1334
Species: Hu
Applications: WB, IHC
MAB2327
Species: Hu
Applications: WB, IP

Publications for Thrombospondin-3 Antibody (NBP1-86131) (0)

There are no publications for Thrombospondin-3 Antibody (NBP1-86131).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thrombospondin-3 Antibody (NBP1-86131) (0)

There are no reviews for Thrombospondin-3 Antibody (NBP1-86131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Thrombospondin-3 Antibody (NBP1-86131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thrombospondin-3 Products

Bioinformatics Tool for Thrombospondin-3 Antibody (NBP1-86131)

Discover related pathways, diseases and genes to Thrombospondin-3 Antibody (NBP1-86131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thrombospondin-3 Antibody (NBP1-86131)

Discover more about diseases related to Thrombospondin-3 Antibody (NBP1-86131).
 

Pathways for Thrombospondin-3 Antibody (NBP1-86131)

View related products by pathway.

PTMs for Thrombospondin-3 Antibody (NBP1-86131)

Learn more about PTMs related to Thrombospondin-3 Antibody (NBP1-86131).

Blogs on Thrombospondin-3

There are no specific blogs for Thrombospondin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thrombospondin-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THBS3
Entrez