Recombinant Bacterial Thioredoxin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Thioredoxin Peptides and Proteins

Order Details


    • Catalog Number
      P4981
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Bacterial Thioredoxin Protein Summary

Description
A partial recombinant protein with His tag corresponding to the amino acids 2 - 109 of trxA

Source: Escherichia coli

Amino Acid Sequence:MHHHHHHMGSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS

Preparation
Method
Escherichia coli expression system
Details of Functionality
Specific activity is 16~18 A650/min/mg and was obtained by measuring the increase of insulin precipitation in absorbance at 650 nm resulting from the reduction of insulin.
Protein/Peptide Type
Recombinant Protein
Gene
TXN

Applications/Dilutions

Application Notes
This product is useful for SDS-PAGE,Func.

Reactivity Notes

Escherichia coli

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
In 20 mM Tris-HCl, pH 8.0 (1 mM DTT, 10% glycerol)
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Bacterial Thioredoxin Protein

  • ADF
  • ATL-derived factor
  • MGC61975
  • SASP
  • Surface-associated sulphydryl protein
  • thioredoxin
  • TRDX
  • Trx
  • TRX1
  • TRXDKFZp686B1993

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
AF3254
Species: Hu, Mu, Rt
Applications: WB
MAB6967
Species: Hu
Applications: WB
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, IHC-P, IP, PLA
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF3119
Species: Mu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
P4981
Species: Ba
Applications: Func, PAGE

Publications for Thioredoxin Recombinant Protein (P4981) (0)

There are no publications for Thioredoxin Recombinant Protein (P4981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thioredoxin Recombinant Protein (P4981) (0)

There are no reviews for Thioredoxin Recombinant Protein (P4981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Thioredoxin Recombinant Protein (P4981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thioredoxin Products

Bioinformatics Tool for Thioredoxin Recombinant Protein (P4981)

Discover related pathways, diseases and genes to Thioredoxin Recombinant Protein (P4981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thioredoxin Recombinant Protein (P4981)

Discover more about diseases related to Thioredoxin Recombinant Protein (P4981).
 

Pathways for Thioredoxin Recombinant Protein (P4981)

View related products by pathway.

PTMs for Thioredoxin Recombinant Protein (P4981)

Learn more about PTMs related to Thioredoxin Recombinant Protein (P4981).
 

Research Areas for Thioredoxin Recombinant Protein (P4981)

Find related products by research area.

Blogs on Thioredoxin

There are no specific blogs for Thioredoxin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Bacterial Thioredoxin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TXN