Thioredoxin Antibody (2A7)

Images

 
Western Blot: Thioredoxin Antibody (2A7) [H00007295-M01] - TXN monoclonal antibody (M01), clone 2A7 Analysis of TXN expression in HeLa.
Immunocytochemistry/ Immunofluorescence: Thioredoxin Antibody (2A7) [H00007295-M01] - Analysis of monoclonal antibody to TXN on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Thioredoxin Antibody (2A7) [H00007295-M01] - Analysis of TXN expression in transfected 293T cell line by TXN monoclonal antibody (M01), clone 2A7.Lane 1: TXN transfected lysate(11.7 KDa).Lane 2: ...read more
Immunoprecipitation: Thioredoxin Antibody (2A7) [H00007295-M01] - Analysis of TXN transfected lysate using anti-TXN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TXN MaxPab rabbit polyclonal ...read more
ELISA: Thioredoxin Antibody (2A7) [H00007295-M01] - Detection limit for recombinant GST tagged TXN is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP
Clone
2A7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Thioredoxin Antibody (2A7) Summary

Immunogen
TXN (AAH03377, 1 a.a. - 105 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Localization
Cytoplasmic and Secreted.
Specificity
TXN - thioredoxin
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TXN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00007295-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Thioredoxin Antibody (2A7)

  • ADF
  • ATL-derived factor
  • MGC61975
  • SASP
  • Surface-associated sulphydryl protein
  • thioredoxin
  • TRDX
  • Trx
  • TRX1
  • TRXDKFZp686B1993

Background

Thioredoxin is a 12-kD oxidoreductase enzyme containing a dithiol-disulfide active site. It is ubiquitous and found in many organisms from plants and bacteria to mammals. Multiple in vitro substrates for thioredoxin have been identified, including ribonuclease, choriogonadotropins, coagulation factors, glucocorticoid receptor, and insulin. Reduction of insulin is classically used as an activity test.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
AF3254
Species: Hu, Mu, Rt
Applications: WB
MAB6967
Species: Hu
Applications: WB
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, IHC-P, IP, PLA
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF3119
Species: Mu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00007295-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for Thioredoxin Antibody (H00007295-M01)(1)

Reviews for Thioredoxin Antibody (H00007295-M01) (0)

There are no reviews for Thioredoxin Antibody (H00007295-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Thioredoxin Antibody (H00007295-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thioredoxin Products

Bioinformatics Tool for Thioredoxin Antibody (H00007295-M01)

Discover related pathways, diseases and genes to Thioredoxin Antibody (H00007295-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thioredoxin Antibody (H00007295-M01)

Discover more about diseases related to Thioredoxin Antibody (H00007295-M01).
 

Pathways for Thioredoxin Antibody (H00007295-M01)

View related products by pathway.

PTMs for Thioredoxin Antibody (H00007295-M01)

Learn more about PTMs related to Thioredoxin Antibody (H00007295-M01).
 

Research Areas for Thioredoxin Antibody (H00007295-M01)

Find related products by research area.

Blogs on Thioredoxin

There are no specific blogs for Thioredoxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thioredoxin Antibody (2A7) and receive a gift card or discount.

Bioinformatics

Gene Symbol TXN
Entrez
OMIM
Uniprot