TfR (Transferrin R) Antibody (1H5)

Images

 

Product Details

Summary
Product Discontinued
View other related TfR (Transferrin R) Primary Antibodies

Order Details


    • Catalog Number
      H00007037-M02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TfR (Transferrin R) Antibody (1H5) Summary

Immunogen
TFRC (AAH01188 68 a.a. - 168 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALY
Marker
Recycling Endosome Marker
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TFRC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TfR (Transferrin R) Antibody (1H5)

  • CD71 antigen
  • CD71
  • CD71TRFR
  • p90
  • T9
  • TfR (Transferrin R)
  • TfR (TransferrinR)
  • TfR
  • TFR1
  • TFRC
  • TR
  • transferrin receptor (p90, CD71)
  • transferrin receptor protein 1
  • TRFR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS

Publications for TfR (Transferrin R) Antibody (H00007037-M02) (0)

There are no publications for TfR (Transferrin R) Antibody (H00007037-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TfR (Transferrin R) Antibody (H00007037-M02) (0)

There are no reviews for TfR (Transferrin R) Antibody (H00007037-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TfR (Transferrin R) Antibody (H00007037-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TfR (Transferrin R) Products

Bioinformatics Tool for TfR (Transferrin R) Antibody (H00007037-M02)

Discover related pathways, diseases and genes to TfR (Transferrin R) Antibody (H00007037-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TfR (Transferrin R) Antibody (H00007037-M02)

Discover more about diseases related to TfR (Transferrin R) Antibody (H00007037-M02).
 

Pathways for TfR (Transferrin R) Antibody (H00007037-M02)

View related products by pathway.

PTMs for TfR (Transferrin R) Antibody (H00007037-M02)

Learn more about PTMs related to TfR (Transferrin R) Antibody (H00007037-M02).
 

Research Areas for TfR (Transferrin R) Antibody (H00007037-M02)

Find related products by research area.

Blogs on TfR (Transferrin R).

Transferrin and the blood brain barrier
Transferrin, an iron binding protein that facilitates iron uptake in cells, is an integral part of a mechanism that may introduce antibody therapies to the central nervous system. Currently, the brain’s ability to take in antibody therapies i...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TfR (Transferrin R) Antibody (1H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol TFRC
Entrez
Uniprot