TFPT Antibody


Immunohistochemistry-Paraffin: TFPT Antibody [NBP1-89106] - Staining of human liver shows strong nuclear positivity in hepatocytes.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

TFPT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQFTIVLEDEGSQGTDAPTPGNAENEPPEKETLS
Specificity of human TFPT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TFPT Protein (NBP1-89106PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TFPT Antibody

  • amida
  • INO80 complex subunit F
  • partner of the E2A
  • Protein FB1
  • TCF3 (E2A) fusion partner (in childhood Leukemia)
  • TCF3 fusion partner


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TFPT Antibody (NBP1-89106) (0)

There are no publications for TFPT Antibody (NBP1-89106).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFPT Antibody (NBP1-89106) (0)

There are no reviews for TFPT Antibody (NBP1-89106). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TFPT Antibody (NBP1-89106) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TFPT Products

Array NBP1-89106

Bioinformatics Tool for TFPT Antibody (NBP1-89106)

Discover related pathways, diseases and genes to TFPT Antibody (NBP1-89106). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFPT Antibody (NBP1-89106)

Discover more about diseases related to TFPT Antibody (NBP1-89106).

Pathways for TFPT Antibody (NBP1-89106)

View related products by pathway.

PTMs for TFPT Antibody (NBP1-89106)

Learn more about PTMs related to TFPT Antibody (NBP1-89106).

Blogs on TFPT

There are no specific blogs for TFPT, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TFPT Antibody and receive a gift card or discount.


Gene Symbol TFPT