TFIIE beta Antibody

Images

 
Western Blot: TFIIE beta Antibody [NBP1-69223] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related TFIIE beta Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69223
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TFIIE beta Antibody Summary

Immunogen
Synthetic peptides corresponding to GTF2E2 (general transcription factor IIE, polypeptide 2, beta 34kDa) The peptide sequence was selected from the N terminal of GTF2E2. Peptide sequence MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSG.
Specificity
This product is specific to Subunit or Isofrom: beta.
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2E2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GTF2E2 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TFIIE beta Antibody

  • FE
  • General transcription factor IIE subunit 2
  • general transcription factor IIE, polypeptide 2 (beta subunit, 34kD)
  • general transcription factor IIE, polypeptide 2, beta 34kDa
  • TF2E2TFIIE-beta
  • TFIIE-B
  • transcription initiation factor IIE subunit beta

Background

GTF2E2 recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-35213
Species: Hu
AF2009
Species: Hu
Applications: WB, IHC
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81029
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TFIIE beta Antibody (NBP1-69223) (0)

There are no publications for TFIIE beta Antibody (NBP1-69223).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFIIE beta Antibody (NBP1-69223) (0)

There are no reviews for TFIIE beta Antibody (NBP1-69223). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFIIE beta Antibody (NBP1-69223) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFIIE beta Products

Bioinformatics Tool for TFIIE beta Antibody (NBP1-69223)

Discover related pathways, diseases and genes to TFIIE beta Antibody (NBP1-69223). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFIIE beta Antibody (NBP1-69223)

Discover more about diseases related to TFIIE beta Antibody (NBP1-69223).

Blogs on TFIIE beta

There are no specific blogs for TFIIE beta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFIIE beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2E2
Uniprot