Tesmin Antibody (4H4) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Tesmin Primary Antibodies

Order Details


    • Catalog Number
      H00009633-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Tesmin Antibody (4H4) [PerCP] Summary

Immunogen
MTL5 (NP_004914, 399 a.a. ~ 509 a.a) partial recombinant protein with GST tag.GCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPR FSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQ MILEEFGRCLSQILHTEFKSKGLKME
Localization
Cytoplasmic and Nuclear
Specificity
MTL5 - metallothionein-like 5, testis-specific (tesmin)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MTL5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tesmin Antibody (4H4) [PerCP]

  • CXC domain containing 2
  • CXCDC2
  • metallothionein-like 5, testis-specific (tesmin)
  • Metallothionein-like 5, testis-specific
  • MTLT
  • tesmin
  • Testis-specific metallothionein-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-92065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
H00058524-R01
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00007150-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56883
Species: Hu
Applications: IHC, IHC-P
NBP2-03456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14194
Species: Hu
Applications: IHC, IHC-P
H00009633-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Tesmin Antibody (H00009633-M01PCP) (0)

There are no publications for Tesmin Antibody (H00009633-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tesmin Antibody (H00009633-M01PCP) (0)

There are no reviews for Tesmin Antibody (H00009633-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tesmin Antibody (H00009633-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tesmin Products

Bioinformatics Tool for Tesmin Antibody (H00009633-M01PCP)

Discover related pathways, diseases and genes to Tesmin Antibody (H00009633-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Tesmin Antibody (H00009633-M01PCP)

Find related products by research area.

Blogs on Tesmin

There are no specific blogs for Tesmin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tesmin Antibody (4H4) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol MTL5