Tensin 4/CTEN Antibody

Images

 
Western Blot: Tensin 4/CTEN Antibody [NBP1-85387] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: Tensin 4/CTEN Antibody [NBP1-85387] - Staining of human placenta shows strong nuclear membranous positivity in trophoblastic cells and decidua cells.
Western Blot: Tensin 4/CTEN Antibody [NBP1-85387] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Product Details

Summary
Product Discontinued
View other related Tensin 4/CTEN Primary Antibodies

Order Details


    • Catalog Number
      NBP1-85387
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Tensin 4/CTEN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SAFVCQHSIMALALPCKLTIPQRELGGADGASDSTDSPASCQKKSAGCHTLYLSSVSVETLTGALAVQKAISTTFERDILPTPTVVHFKVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNS4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tensin 4/CTEN Antibody

  • CTEN
  • CTENC terminal tensin like
  • C-terminal tensin-like protein
  • FLJ14950
  • Tensin 4
  • tensin-4
  • TNS4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP

Publications for Tensin 4/CTEN Antibody (NBP1-85387) (0)

There are no publications for Tensin 4/CTEN Antibody (NBP1-85387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tensin 4/CTEN Antibody (NBP1-85387) (0)

There are no reviews for Tensin 4/CTEN Antibody (NBP1-85387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tensin 4/CTEN Antibody (NBP1-85387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tensin 4/CTEN Products

Bioinformatics Tool for Tensin 4/CTEN Antibody (NBP1-85387)

Discover related pathways, diseases and genes to Tensin 4/CTEN Antibody (NBP1-85387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tensin 4/CTEN Antibody (NBP1-85387)

Discover more about diseases related to Tensin 4/CTEN Antibody (NBP1-85387).
 

Pathways for Tensin 4/CTEN Antibody (NBP1-85387)

View related products by pathway.

Blogs on Tensin 4/CTEN

There are no specific blogs for Tensin 4/CTEN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tensin 4/CTEN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNS4
Entrez