TEN1 Antibody


Immunohistochemistry-Paraffin: TEN1 Antibody [NBP1-91119] Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Product Discontinued
View other related TEN1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TEN1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MMLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TEN1 Antibody

  • C17orf106
  • CST complex subunit TEN1
  • FLJ39785
  • MGC54300
  • protein telomeric pathways with STN1 homolog
  • telomere length regulation protein TEN1 homolog
  • telomeric pathways in association with Stn1, number 1
  • TEN1 telomerase capping complex subunit homolog (S. cerevisiae)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P

Publications for TEN1 Antibody (NBP1-91119) (0)

There are no publications for TEN1 Antibody (NBP1-91119).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEN1 Antibody (NBP1-91119) (0)

There are no reviews for TEN1 Antibody (NBP1-91119). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TEN1 Antibody (NBP1-91119) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TEN1 Antibody and receive a gift card or discount.


Gene Symbol TEN1