TEM8/ANTXR1 Antibody

Images

 
Western Blot: TEM8 Antibody [NBP1-69501] - This Anti-ANTXR1 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Product Discontinued
View other related TEM8/ANTXR1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69501
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TEM8/ANTXR1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ANTXR1(anthrax toxin receptor 1) The peptide sequence was selected from the middle region of ANTXR1. Peptide sequence VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK.
Clonality
Polyclonal
Host
Rabbit
Gene
ANTXR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ANTXR1 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TEM8/ANTXR1 Antibody

  • anthrax toxin receptor 1
  • ANTXR1
  • ATR2310008J16Rik
  • FLJ10601
  • FLJ11298
  • FLJ21776
  • TEM8
  • TEM82810405N18Rik
  • Tumor endothelial marker 8

Background

ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes.The protein encoded by this gene is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. This protein has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax. The binding of the protective antigen (PA) component, of the tripartite anthrax toxin, to this receptor protein mediates delivery of toxin components to the cytosol of cells. Once inside the cell, the other two components of anthrax toxin, edema factor (EF) and lethal factor (LF) disrupt normal cellular processes. Three alternatively spliced variants have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF2940
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-07799
Species: Hu
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-02004
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-69501
Species: Hu
Applications: WB

Publications for TEM8/ANTXR1 Antibody (NBP1-69501) (0)

There are no publications for TEM8/ANTXR1 Antibody (NBP1-69501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEM8/ANTXR1 Antibody (NBP1-69501) (0)

There are no reviews for TEM8/ANTXR1 Antibody (NBP1-69501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEM8/ANTXR1 Antibody (NBP1-69501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEM8/ANTXR1 Products

Bioinformatics Tool for TEM8/ANTXR1 Antibody (NBP1-69501)

Discover related pathways, diseases and genes to TEM8/ANTXR1 Antibody (NBP1-69501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEM8/ANTXR1 Antibody (NBP1-69501)

Discover more about diseases related to TEM8/ANTXR1 Antibody (NBP1-69501).
 

Pathways for TEM8/ANTXR1 Antibody (NBP1-69501)

View related products by pathway.

PTMs for TEM8/ANTXR1 Antibody (NBP1-69501)

Learn more about PTMs related to TEM8/ANTXR1 Antibody (NBP1-69501).
 

Research Areas for TEM8/ANTXR1 Antibody (NBP1-69501)

Find related products by research area.

Blogs on TEM8/ANTXR1

There are no specific blogs for TEM8/ANTXR1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEM8/ANTXR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANTXR1
Entrez
Uniprot