Recombinant Human TEKT2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TEKT2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-99 of Human TEKT2

Source: Wheat Germ

Amino Acid Sequence: MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TEKT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TEKT2 Protein

  • h-tektin-t
  • TEKTB1tektin-B1
  • tektin 2 (testicular)
  • tektin-2
  • Tektin-B1
  • TEKTIN-T
  • Testicular tektin B1-like protein
  • Testicular tektin

Background

TEKT2 - tektin 2 (testicular)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-82773
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-31318
Species: Mu
Applications: IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-53165
Species: Hu
Applications: WB
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38634
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82600
Species: Hu
Applications: IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-85704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
H00027285-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TEKT2 Partial Recombinant Protein (H00027285-Q01) (0)

There are no publications for TEKT2 Partial Recombinant Protein (H00027285-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEKT2 Partial Recombinant Protein (H00027285-Q01) (0)

There are no reviews for TEKT2 Partial Recombinant Protein (H00027285-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEKT2 Partial Recombinant Protein (H00027285-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TEKT2 Products

Bioinformatics Tool for TEKT2 Partial Recombinant Protein (H00027285-Q01)

Discover related pathways, diseases and genes to TEKT2 Partial Recombinant Protein (H00027285-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TEKT2 Partial Recombinant Protein (H00027285-Q01)

View related products by pathway.

Blogs on TEKT2

There are no specific blogs for TEKT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TEKT2 Antibody
NBP1-86955

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TEKT2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TEKT2