TEF1 Antibody

Images

 
Immunohistochemistry-Paraffin: TEF1 Antibody [NBP3-10510] - Immunohistochemical analysis of paraffin-embedded human lung tissue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEF1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TEF1 (NP_068780). Peptide sequence YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK
Clonality
Polyclonal
Host
Rabbit
Gene
TEAD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for TEF1 Antibody

  • NTEF-1
  • Protein GT-IIC
  • TCF13
  • TCF-13
  • TEA domain family member 1 (SV40 transcriptional enhancer factor)
  • TEAD1
  • TEAD-1
  • TEF1

Background

TEF1 binds specifically and cooperatively to the SPH and GT IIC quot enhansons quot; (GTGGAATGT) and activates transcription in vivo in a cell specific manner. The activation function appears to be mediated by a limiting cell specific transcriptional intermediary factor (TIF). It is involved in cardiac development and also binds to the MCAT motif.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

210-TA
Species: Hu
Applications: BA
MAB5018
Species: Hu
Applications: IP, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
D6050
Species: Hu
Applications: ELISA
DY417
Species: Mu
Applications: ELISA
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
H00008398-D01P
Species: Hu, Mu
Applications: WB
DTM100
Species: Hu
Applications: ELISA
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for TEF1 Antibody (NBP3-10510) (0)

There are no publications for TEF1 Antibody (NBP3-10510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEF1 Antibody (NBP3-10510) (0)

There are no reviews for TEF1 Antibody (NBP3-10510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEF1 Antibody (NBP3-10510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEF1 Products

Array NBP3-10510

Bioinformatics Tool for TEF1 Antibody (NBP3-10510)

Discover related pathways, diseases and genes to TEF1 Antibody (NBP3-10510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEF1 Antibody (NBP3-10510)

Discover more about diseases related to TEF1 Antibody (NBP3-10510).
 

Pathways for TEF1 Antibody (NBP3-10510)

View related products by pathway.

PTMs for TEF1 Antibody (NBP3-10510)

Learn more about PTMs related to TEF1 Antibody (NBP3-10510).
 

Research Areas for TEF1 Antibody (NBP3-10510)

Find related products by research area.

Blogs on TEF1.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEAD1