Home » TEF1 » TEF1 Antibodies » TEF1 Antibody

TEF1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: TEF1 Antibody [NBP3-10510] - Immunohistochemical analysis of paraffin-embedded human lung tissue.
Immunohistochemistry-Paraffin: TEF1 Antibody [NBP3-10510] - Immunohistochemical analysis of paraffin-embedded human lung tissue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TEF1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TEF1 (NP_068780). Peptide sequence YMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVK
Clonality
Polyclonal
Host
Rabbit
Gene
TEAD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for TEF1 Antibody

  • NTEF-1
  • Protein GT-IIC
  • TCF13
  • TCF-13
  • TEA domain family member 1 (SV40 transcriptional enhancer factor)
  • TEAD1
  • TEAD-1
  • TEF1

Background

TEF1 binds specifically and cooperatively to the SPH and GT IIC quot enhansons quot; (GTGGAATGT) and activates transcription in vivo in a cell specific manner. The activation function appears to be mediated by a limiting cell specific transcriptional intermediary factor (TIF). It is involved in cardiac development and also binds to the MCAT motif.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
PLA2G1B Antibody
(630823)
MAB5018
Western blot shows lysates of human pancreas tissue. PVDF Membrane was probed with 2 µg/mL of Human PLA2G1B Monoclonal Antibody (Catalog # MAB5018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PLA2G1B at approximately 17 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: IP, WB
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining in human epididymis and skeletal muscle tissues using anti-AGA antibody. Corresponding AGA RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
GLS2 Antibody -
BSA Free
NBP1-76544
Western Blot: GLS2 Antibody [NBP1-76544] - Glutaminase protein expression in PC3 and PC3M cell lines before/after CB-839 treatment. PC3 & PC3M cells were treated (+) or not treated (-) with GLS1 inhibitor CB-839 (1 uM) and their expression of GLS1 & GLS2 proteins determined by Western blot. Antibodies specific for GAC & KCA were utilized on two replicate samples, while GLS2 expression was determined on three. PC3 cell lysates expressed GLS2 more than PC3M cell lysates regardless of CB-839 treatment. The difference in GLS2 expression was significant in the untreated cells (P?<?0.03) but because of high variability the difference was not significant in the drug-treated cells. Levels of GLS1 (GAC and KGA) were similar in all cell lysates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-16327-z), licensed under a CC-BY licence.
Immunohistochemistry: GLS2 Antibody [NBP1-76544] - Immunohistochemistry of GLS2 in human kidney tissue with GLS2 antibody at 5 ug/mL.
Immunocytochemistry/Immunofluorescence: GLS2 Antibody [NBP1-76544] - of GLS2 in Human Kidney cells. Dilution 20 ug/mL.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Phospholipase B1
Antibody
H00151056-B01P
Western Blot: Phospholipase B1 Antibody [H00151056-B01P] - Analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu, Mu
Applications: WB
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Simple Western lane view shows lysates of SH‑SY5Y human neuroblastoma cell line, loaded at 0.5 mg/mL. A specific band was detected for 14‑3‑3 zeta at approximately 34 kDa (as indicated) using 2 µg/mL of Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line,SK‑Mel‑28 human malignant melanoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and C6 rat glioma cell line. PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human14‑3‑3 zeta  Monoclonal Antibody (Catalog # MAB2669) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for14‑3‑3 zeta at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
14‑3‑3 zeta  was detected in immersion fixed paraffin-embedded sections of human squamous cell carcinoma using Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei and plasma membrane. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
Species: Hu
Applications: IHC, Simple Western, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody (NB100-689).
Simple Western: COX-2 Antibody [NB100-689] - Simple Western lane view shows a specific band for COX2 in 1.0 mg/ml of Rat Brain at an antibody concentration of 1:100. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Image provided through customer review.
(1 Review)
(33 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(16 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
IL-6 [HRP]
D6050
(700 Publications)
Species: Hu
Applications: ELISA
IL-10 [Biotin]
DY417
(265 Publications)
Species: Mu
Applications: ELISA
ASAH1 Antibody
NBP1-89296
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human kidney shows strong granular cytoplasmic positivity in a subset of renal tubules.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
(6 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PLA2G2A Antibody
[Unconjugated]
AF4925
Western blot shows lysates of mouse small intestine tissue. PVDF Membrane was probed with 0.5 µg/mL of Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PLA2G2A at approximately 17 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PLA2G2A was detected in perfusion fixed frozen sections of mouse intestine using Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells in intestinal glands. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of mouse small intestine tissue, loaded at 0.2 mg/mL. A specific band was detected for PLA2G2A at approximately 27 kDa (as indicated) using 5 µg/mL of Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Mu
Applications: IHC, Simple Western, WB
PLA2G6 Antibody
H00008398-D01P
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in human kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in transfected 293T cell line by PLA2G6 polyclonal antibody.Lane 1: PLA2G6 transfected lysate(84.10 KDa).Lane 2: Non-transfected lysate.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in mouse kidney.
Species: Hu, Mu
Applications: WB
TIMP-1 [HRP]
DTM100
(96 Publications)
Species: Hu
Applications: ELISA
COX5A Antibody
NBP1-32550
Western Blot: COX5A Antibody [NBP1-32550] - Various tissue extracts (50 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with COX5A antibody [N1C3] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunohistochemistry-Paraffin: COX5A Antibody [NBP1-32550] - Cal27 xenograft, using COX5A antibody at 1:500 dilution. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Western Blot: COX5A Antibody [NBP1-32550] - Sample (30 ug of whole cell lysate) A: zebrafish eye15% SDS PAGE diluted at 1:1000
(2 Publications)
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
PLA2G4A Antibody
NBP1-31344
Immunocytochemistry/Immunofluorescence: PLA2G4A Antibody [NBP1-31344] - Analysis of HeLa, using NBP1-31344 at 1:200 dilution.
Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP1-31344] - U87 xenograft, using PLA2G4A antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: PLA2G4A Antibody [NBP1-31344] - Sample (30 ug of whole cell lysate) A: NIH-3T3 7.5% SDS PAGE; antibody diluted at 1:1000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
CPOX Antibody
(36B10) - BSA Free
NBP2-59438
Immunocytochemistry/Immunofluorescence: CPOX Antibody (36B10) [NBP2-59438] - Analysis of CPOX in Hep3B cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CPOX antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Western Blot: CPOX Antibody (36B10) [NBP2-59438] - Lane 1: Recombinant protein CPOX, Lane 2: 293T cell lysates, Lane 3: HepG2 cell lysates, Lane 4: A549 cell lysates, Lane 5: Jurkat cell lysates, Lane 6: K562 cell lysates, Lane 7: LnCaP cell lysates
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for TEF1 Antibody (NBP3-10510) (0)

There are no publications for TEF1 Antibody (NBP3-10510).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEF1 Antibody (NBP3-10510) (0)

There are no reviews for TEF1 Antibody (NBP3-10510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEF1 Antibody (NBP3-10510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEF1 Products

Array NBP3-10510

Bioinformatics Tool for TEF1 Antibody (NBP3-10510)

Discover related pathways, diseases and genes to TEF1 Antibody (NBP3-10510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEF1 Antibody (NBP3-10510)

Discover more about diseases related to TEF1 Antibody (NBP3-10510).
 

Pathways for TEF1 Antibody (NBP3-10510)

View related products by pathway.

PTMs for TEF1 Antibody (NBP3-10510)

Learn more about PTMs related to TEF1 Antibody (NBP3-10510).
 

Research Areas for TEF1 Antibody (NBP3-10510)

Find related products by research area.

Blogs on TEF1.

Check out the latest blog posts on TEF1.

  Read full blog post.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEF1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TEAD1