TEAD3 Antibody (1C4) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related TEAD3 Primary Antibodies

Order Details


    • Catalog Number
      H00007005-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TEAD3 Antibody (1C4) [DyLight 488] Summary

Immunogen
TEAD3 (NP_003205 215 a.a. - 302 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWAD
Specificity
TEAD3 (1C4)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TEAD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TEAD3 Antibody (1C4) [DyLight 488]

  • DTEF-1
  • ETFR-1
  • TEA domain family member 3TEAD-3
  • TEAD5TEF5TEA domain family member 5
  • TEF-5
  • transcriptional enhancer factor 5
  • Transcriptional enhancer factor TEF-5 (DTEF-1)
  • transcriptional enhancer factor TEF-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
H00007004-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, RNAi
H00007008-T01
Species: Hu
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF5626
Species: Hu
Applications: WB, ICC
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-16613
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007005-M01G
Species: Hu
Applications: ELISA, ICC/IF

Publications for TEAD3 Antibody (H00007005-M01G) (0)

There are no publications for TEAD3 Antibody (H00007005-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEAD3 Antibody (H00007005-M01G) (0)

There are no reviews for TEAD3 Antibody (H00007005-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TEAD3 Antibody (H00007005-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEAD3 Products

Bioinformatics Tool for TEAD3 Antibody (H00007005-M01G)

Discover related pathways, diseases and genes to TEAD3 Antibody (H00007005-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEAD3 Antibody (H00007005-M01G)

Discover more about diseases related to TEAD3 Antibody (H00007005-M01G).
 

Pathways for TEAD3 Antibody (H00007005-M01G)

View related products by pathway.

PTMs for TEAD3 Antibody (H00007005-M01G)

Learn more about PTMs related to TEAD3 Antibody (H00007005-M01G).

Blogs on TEAD3

There are no specific blogs for TEAD3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEAD3 Antibody (1C4) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol TEAD3