TdT Antibody (4H5)

Images

 
Western Blot: TdT Antibody (4H5) [H00001791-M01] - Analysis of DNTT expression in transfected 293T cell line by DNTT monoclonal antibody (M01), clone 4H5.Lane 1: DNTT transfected lysate (Predicted MW: 58.4 KDa).Lane 2: ...read more
Sandwich ELISA: TdT Antibody (4H5) [H00001791-M01] - Detection limit for recombinant GST tagged DNTT is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TdT Antibody (4H5) Summary

Immunogen
DNTT (AAH12920, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC
Localization
Nuclear
Specificity
DNTT - deoxynucleotidyltransferase, terminal
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DNTT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TdT Antibody (4H5)

  • deoxynucleotidyltransferase, terminal
  • DNTT
  • EC 2.7.7
  • EC 2.7.7.31
  • nucleosidetriphosphate:DNA deoxynucleotidylexotransferase
  • TdT
  • TDTDNA nucleotidylexotransferase
  • Terminal addition enzyme
  • Terminal deoxynucleotidyltransferase
  • terminal deoxyribonucleotidyltransferase
  • Terminal transferase

Background

This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
AF7579
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00001791-M01
Species: Hu
Applications: WB, ELISA

Publications for TdT Antibody (H00001791-M01) (0)

There are no publications for TdT Antibody (H00001791-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TdT Antibody (H00001791-M01) (0)

There are no reviews for TdT Antibody (H00001791-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TdT Antibody (H00001791-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TdT Products

Bioinformatics Tool for TdT Antibody (H00001791-M01)

Discover related pathways, diseases and genes to TdT Antibody (H00001791-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TdT Antibody (H00001791-M01)

Discover more about diseases related to TdT Antibody (H00001791-M01).
 

Pathways for TdT Antibody (H00001791-M01)

View related products by pathway.

PTMs for TdT Antibody (H00001791-M01)

Learn more about PTMs related to TdT Antibody (H00001791-M01).
 

Research Areas for TdT Antibody (H00001791-M01)

Find related products by research area.

Blogs on TdT.

TdT (Terminal Deoxynucleotidyl Transferase)
The enzyme family of DNA polymerases plays a fundamental role in the replication, repair, and recombination of nucleic acid. Its members include DNA Polymerase b (Pol b), DNA Polymerase g (Pol g), and DNA Polymerase m (Pol m). TdT is a very unique and...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TdT Antibody (4H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol DNTT
Entrez
OMIM
Uniprot