TDP-43/TARDBP Antibody (2E2-D3) [Alexa Fluor® 488]

Images

 

Product Details

Summary
Product Discontinued
View other related TDP-43/TARDBP Primary Antibodies

Order Details


    • Catalog Number
      H00023435-M01AF488
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TDP-43/TARDBP Antibody (2E2-D3) [Alexa Fluor® 488] Summary

Immunogen
TARDBP (AAH01487, 1 a.a. ~ 260 a.a) full length recombinant protein with GST tag. Molecular weight of GST Tag is 26KDa alone. MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV
Localization
H00023435-M01 Nucleus.
Specificity
TARDBP - TAR DNA binding protein
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TARDBP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Cross reactivity in Mouse and Rat reported by customer review. Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for TDP-43/TARDBP Antibody (2E2-D3) [Alexa Fluor® 488]

  • ALS10
  • ALS10TAR DNA-binding protein-43
  • TAR DNA binding protein
  • TARDBP
  • TDP43
  • TDP-43
  • TDP-43TAR DNA-binding protein 43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1436
Species: Mu
Applications: WB
AF2420
Species: Hu
Applications: WB, IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
MAB7509
Species: Hu
Applications: WB, IHC
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NBP1-93504
Species: Hu
Applications: IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TDP-43/TARDBP Antibody (H00023435-M01AF488) (0)

There are no publications for TDP-43/TARDBP Antibody (H00023435-M01AF488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDP-43/TARDBP Antibody (H00023435-M01AF488) (0)

There are no reviews for TDP-43/TARDBP Antibody (H00023435-M01AF488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TDP-43/TARDBP Antibody (H00023435-M01AF488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDP-43/TARDBP Products

Bioinformatics Tool for TDP-43/TARDBP Antibody (H00023435-M01AF488)

Discover related pathways, diseases and genes to TDP-43/TARDBP Antibody (H00023435-M01AF488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDP-43/TARDBP Antibody (H00023435-M01AF488)

Discover more about diseases related to TDP-43/TARDBP Antibody (H00023435-M01AF488).
 

Pathways for TDP-43/TARDBP Antibody (H00023435-M01AF488)

View related products by pathway.

PTMs for TDP-43/TARDBP Antibody (H00023435-M01AF488)

Learn more about PTMs related to TDP-43/TARDBP Antibody (H00023435-M01AF488).
 

Research Areas for TDP-43/TARDBP Antibody (H00023435-M01AF488)

Find related products by research area.

Blogs on TDP-43/TARDBP

There are no specific blogs for TDP-43/TARDBP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDP-43/TARDBP Antibody (2E2-D3) [Alexa Fluor® 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol TARDBP
Entrez