Recombinant Human TCTE3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TCTE3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 99-198 of Human TCTE3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE

Protein/Peptide Type
Partial Recombinant Protein
Gene
TCTE3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TCTE3 Protein

  • MGC142199
  • T-complex testis-specific protein 3
  • T-complex-associated testis-expressed protein 3
  • t-complex-associated-testis-expressed 3
  • tcte-3
  • tctex1 domain-containing protein 3
  • TCTEX1D3Tctex1 domain containing 3

Background

TCTE3 - t-complex-associated-testis-expressed 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13798
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58497
Species: Hu
Applications: WB, ICC/IF
NBP2-24490
Species: Hu, Ca, Eq, Pm
Applications: WB, IHC-P
AF877
Species: Hu
Applications: WB, IHC, IP
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP1-85605
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NBP1-76993
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86566
Species: Hu
Applications: WB, IHC, IHC-P
H00006991-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TCTE3 Partial Recombinant Protein (H00006991-Q01) (0)

There are no publications for TCTE3 Partial Recombinant Protein (H00006991-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCTE3 Partial Recombinant Protein (H00006991-Q01) (0)

There are no reviews for TCTE3 Partial Recombinant Protein (H00006991-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCTE3 Partial Recombinant Protein (H00006991-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TCTE3 Products

TCTE3 H00006991-Q01

Bioinformatics Tool for TCTE3 Partial Recombinant Protein (H00006991-Q01)

Discover related pathways, diseases and genes to TCTE3 Partial Recombinant Protein (H00006991-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCTE3 Partial Recombinant Protein (H00006991-Q01)

Discover more about diseases related to TCTE3 Partial Recombinant Protein (H00006991-Q01).
 

Pathways for TCTE3 Partial Recombinant Protein (H00006991-Q01)

View related products by pathway.

PTMs for TCTE3 Partial Recombinant Protein (H00006991-Q01)

Learn more about PTMs related to TCTE3 Partial Recombinant Protein (H00006991-Q01).

Blogs on TCTE3

There are no specific blogs for TCTE3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TCTE3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TCTE3