TCF7L2 Antibody (3A4) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related TCF7L2 Primary Antibodies

Order Details


    • Catalog Number
      H00006934-M06PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TCF7L2 Antibody (3A4) [PerCP] Summary

Immunogen
TCF7L2 (NP_110383 490 a.a. - 596 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE
Specificity
TCF7L2 (3A4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TCF7L2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCF7L2 Antibody (3A4) [PerCP]

  • HMG box transcription factor 4
  • hTCF-4
  • T-cell factor 4
  • T-cell factor-4 variant A
  • T-cell factor-4 variant B
  • T-cell factor-4 variant C
  • T-cell factor-4 variant D
  • T-cell factor-4 variant E
  • T-cell factor-4 variant H
  • T-cell factor-4 variant I
  • T-cell factor-4 variant J
  • T-cell factor-4 variant K
  • T-cell factor-4 variant L
  • T-cell factor-4 variant M
  • T-cell factor-4 variant X2
  • T-cell-specific transcription factor 4
  • TCF-4T-cell factor-4 variant F
  • TCF4T-cell factor-4 variant G
  • transcription factor 7-like 2 (T-cell specific, HMG-box)
  • transcription factor 7-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF6116
Species: Hu
Applications: WB, ICC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF4885
Species: Mu
Applications: WB, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB7650
Species: Mu
Applications: WB, IHC
AF5596
Species: Hu
Applications: WB, IHC, ICC
AF7318
Species: Hu
Applications: IHC
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for TCF7L2 Antibody (H00006934-M06PCP) (0)

There are no publications for TCF7L2 Antibody (H00006934-M06PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF7L2 Antibody (H00006934-M06PCP) (0)

There are no reviews for TCF7L2 Antibody (H00006934-M06PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCF7L2 Antibody (H00006934-M06PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF7L2 Products

Bioinformatics Tool for TCF7L2 Antibody (H00006934-M06PCP)

Discover related pathways, diseases and genes to TCF7L2 Antibody (H00006934-M06PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF7L2 Antibody (H00006934-M06PCP)

Discover more about diseases related to TCF7L2 Antibody (H00006934-M06PCP).
 

Pathways for TCF7L2 Antibody (H00006934-M06PCP)

View related products by pathway.

PTMs for TCF7L2 Antibody (H00006934-M06PCP)

Learn more about PTMs related to TCF7L2 Antibody (H00006934-M06PCP).
 

Research Areas for TCF7L2 Antibody (H00006934-M06PCP)

Find related products by research area.

Blogs on TCF7L2

There are no specific blogs for TCF7L2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF7L2 Antibody (3A4) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF7L2