TCF7/TCF1 Antibody (1D2) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related TCF7/TCF1 Primary Antibodies

Order Details


    • Catalog Number
      H00006932-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TCF7/TCF1 Antibody (1D2) [DyLight 488] Summary

Immunogen
TCF7 (NP_003193, 287 a.a. - 384 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL
Localization
Nuclear
Specificity
TCF7 - transcription factor 7 (T-cell specific, HMG-box)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TCF7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCF7/TCF1 Antibody (1D2) [DyLight 488]

  • FLJ36364
  • MGC47735
  • T-cell factor 1
  • T-cell specific
  • TCF1
  • TCF7
  • TCF-7
  • transcription factor 7 (T-cell specific, HMG-box)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00006932-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TCF7/TCF1 Antibody (H00006932-M01G) (0)

There are no publications for TCF7/TCF1 Antibody (H00006932-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF7/TCF1 Antibody (H00006932-M01G) (0)

There are no reviews for TCF7/TCF1 Antibody (H00006932-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCF7/TCF1 Antibody (H00006932-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF7/TCF1 Products

Bioinformatics Tool for TCF7/TCF1 Antibody (H00006932-M01G)

Discover related pathways, diseases and genes to TCF7/TCF1 Antibody (H00006932-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF7/TCF1 Antibody (H00006932-M01G)

Discover more about diseases related to TCF7/TCF1 Antibody (H00006932-M01G).
 

Pathways for TCF7/TCF1 Antibody (H00006932-M01G)

View related products by pathway.

PTMs for TCF7/TCF1 Antibody (H00006932-M01G)

Learn more about PTMs related to TCF7/TCF1 Antibody (H00006932-M01G).
 

Research Areas for TCF7/TCF1 Antibody (H00006932-M01G)

Find related products by research area.

Blogs on TCF7/TCF1

There are no specific blogs for TCF7/TCF1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF7/TCF1 Antibody (1D2) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF7
Entrez