TCEB2 Antibody (6F6) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related TCEB2 Primary Antibodies

Order Details


    • Catalog Number
      H00006923-M01FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TCEB2 Antibody (6F6) [DyLight 680] Summary

Immunogen
TCEB2 (NP_009039, 9 a.a. - 118 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Localization
Nuclear
Specificity
TCEB2 - transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TCEB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCEB2 Antibody (6F6) [DyLight 680]

  • 18-kD subunit
  • EloB
  • Elongin 18 kDa subunit
  • elongin-B
  • RNA polymerase II transcription factor SIII p18 subunit
  • RNA polymerase II transcription factor SIII subunit B
  • SIII p18
  • transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B)
  • transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
  • transcription elongation factor B polypeptide 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-44091
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-26666
Species: Mu
Applications: B/N, Flow, IP, In vitro
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP1-87040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBL1-16214
Species: Hu
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TCEB2 Antibody (H00006923-M01FR) (0)

There are no publications for TCEB2 Antibody (H00006923-M01FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEB2 Antibody (H00006923-M01FR) (0)

There are no reviews for TCEB2 Antibody (H00006923-M01FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCEB2 Antibody (H00006923-M01FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCEB2 Products

Bioinformatics Tool for TCEB2 Antibody (H00006923-M01FR)

Discover related pathways, diseases and genes to TCEB2 Antibody (H00006923-M01FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCEB2 Antibody (H00006923-M01FR)

Discover more about diseases related to TCEB2 Antibody (H00006923-M01FR).
 

Pathways for TCEB2 Antibody (H00006923-M01FR)

View related products by pathway.

PTMs for TCEB2 Antibody (H00006923-M01FR)

Learn more about PTMs related to TCEB2 Antibody (H00006923-M01FR).

Blogs on TCEB2

There are no specific blogs for TCEB2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCEB2 Antibody (6F6) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEB2