TCEA1 Antibody

Images

 
Western Blot: TCEA1 Antibody [NBP1-74107] - Titration: 1.0 ug/ml Positive Control: Mouse Kidney.

Product Details

Summary
Product Discontinued
View other related TCEA1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74107
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TCEA1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Tcea1. Immunizing peptide sequence AKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKF.
Clonality
Polyclonal
Host
Rabbit
Gene
TCEA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Tcea1 and was validated on Western blot.
Positive Control
TCEA1 Lysate (NBP2-65539)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TCEA1 Antibody

  • GTF2Stranscription elongation factor A protein 1
  • SII
  • TF2STCEA
  • TFIISTranscription elongation factor TFIIS.o
  • transcription elongation factor A (SII), 1
  • Transcription elongation factor S-II protein 1

Background

Tcea1 is necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89922
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-83508
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-273
Species: Hu, Mu
Applications: WB, IP
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
H00006827-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45519
Species: Hu
Applications: WB, IHC
NBP2-49349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16019
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-62629
Species: Hu
Applications: IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-47801
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-74107
Species: Mu, Rt
Applications: WB

Publications for TCEA1 Antibody (NBP1-74107) (0)

There are no publications for TCEA1 Antibody (NBP1-74107).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEA1 Antibody (NBP1-74107) (0)

There are no reviews for TCEA1 Antibody (NBP1-74107). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCEA1 Antibody (NBP1-74107) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TCEA1 Antibody (NBP1-74107)

Discover related pathways, diseases and genes to TCEA1 Antibody (NBP1-74107). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCEA1 Antibody (NBP1-74107)

Discover more about diseases related to TCEA1 Antibody (NBP1-74107).
 

Pathways for TCEA1 Antibody (NBP1-74107)

View related products by pathway.

Blogs on TCEA1

There are no specific blogs for TCEA1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCEA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEA1
Uniprot