TBX3 Antibody (8H3) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related TBX3 Primary Antibodies

Order Details


    • Catalog Number
      H00006926-M02FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TBX3 Antibody (8H3) [DyLight 680] Summary

Immunogen
TBX3 (NP_005987 311 a.a. - 410 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Specificity
TBX3 (8H3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TBX3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TBX3 Antibody (8H3) [DyLight 680]

  • bladder cancer related protein XHL
  • T-box 3
  • T-box protein 3
  • T-box transcription factor TBX3
  • TBX3
  • TBX3-ISO
  • ulnar mammary syndrome
  • UMS
  • XHL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89459
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
355-BM/CF
Species: Hu, Mu, Rt
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-58195
Species: Hu
Applications: ICC/IF
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006926-M02FR
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for TBX3 Antibody (H00006926-M02FR) (0)

There are no publications for TBX3 Antibody (H00006926-M02FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX3 Antibody (H00006926-M02FR) (0)

There are no reviews for TBX3 Antibody (H00006926-M02FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBX3 Antibody (H00006926-M02FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBX3 Products

Bioinformatics Tool for TBX3 Antibody (H00006926-M02FR)

Discover related pathways, diseases and genes to TBX3 Antibody (H00006926-M02FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX3 Antibody (H00006926-M02FR)

Discover more about diseases related to TBX3 Antibody (H00006926-M02FR).
 

Pathways for TBX3 Antibody (H00006926-M02FR)

View related products by pathway.

PTMs for TBX3 Antibody (H00006926-M02FR)

Learn more about PTMs related to TBX3 Antibody (H00006926-M02FR).

Blogs on TBX3

There are no specific blogs for TBX3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX3 Antibody (8H3) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX3
Entrez