Recombinant Human TBP like protein TLP Protein

Product Discontinued

Recombinant Human TBP like protein TLP Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 33239 of Human TBPL1 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARRLARSLQKL

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: TBPL1

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBP like protein TLP Protein

• 21 kDa TBP-like protein
• STUD21-kDA TBP-like protein
• TATA box binding protein-related factor 2
• TATA box-binding protein-like protein 1
• TATA box-binding protein-related factor 2
• TBP-like 1
• TBP-like factor
• TBP-like protein 1
• TBP-related factor 2
• TBP-related protein
• TLFMGC:8389
• TLP21
• TLPMGC:9620
• TRF2Second TBP of unique DNA protein
• TRP

Background

TBPL1 - TBP-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBPL1