Recombinant Human TBL1 Protein

Images

 
SDS-Page: Recombinant Human TBL1 Protein [H00006907-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TBL1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 478-577 of Human TBL1X partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBL1X

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBL1 Protein

  • EBI
  • SMAP55
  • TBL1transducin (beta)-like 1
  • transducin (beta)-like 1X-linked
  • X-linked

Background

TBL1X - transducin (beta)-like 1X-linked

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-270
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB100-1669
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-87104
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00900
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for TBL1 Partial Recombinant Protein (H00006907-Q01) (0)

There are no publications for TBL1 Partial Recombinant Protein (H00006907-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBL1 Partial Recombinant Protein (H00006907-Q01) (0)

There are no reviews for TBL1 Partial Recombinant Protein (H00006907-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBL1 Partial Recombinant Protein (H00006907-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBL1 Products

Bioinformatics Tool for TBL1 Partial Recombinant Protein (H00006907-Q01)

Discover related pathways, diseases and genes to TBL1 Partial Recombinant Protein (H00006907-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBL1 Partial Recombinant Protein (H00006907-Q01)

Discover more about diseases related to TBL1 Partial Recombinant Protein (H00006907-Q01).
 

Pathways for TBL1 Partial Recombinant Protein (H00006907-Q01)

View related products by pathway.

PTMs for TBL1 Partial Recombinant Protein (H00006907-Q01)

Learn more about PTMs related to TBL1 Partial Recombinant Protein (H00006907-Q01).
 

Research Areas for TBL1 Partial Recombinant Protein (H00006907-Q01)

Find related products by research area.

Blogs on TBL1

There are no specific blogs for TBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TBL1 Antibody
NB300-872

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBL1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBL1X