Recombinant Human TBK1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TBK1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 630-729 of Human TBK1

Source: Wheat Germ

Amino Acid Sequence: LLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBK1 Protein

  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ11330
  • FTDALS4
  • NAK serine/threonine-protein kinase TBK 1
  • NAK
  • NAKserine/threonine-protein kinase TBK1
  • NF-kappa-B-activating kinase
  • NFKB-Activating Kinase
  • T2K
  • TANK-binding kinase 1NF-kB-activating kinase
  • TBK 1
  • TBK1

Background

TBK1 - TANK-binding kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4019
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NB100-56566
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-61849
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB3199
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67634
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-24683
Species: Hu, Mu, Ca, Pm, RM
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
H00029110-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TBK1 Partial Recombinant Protein (H00029110-Q01) (0)

There are no publications for TBK1 Partial Recombinant Protein (H00029110-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBK1 Partial Recombinant Protein (H00029110-Q01) (0)

There are no reviews for TBK1 Partial Recombinant Protein (H00029110-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBK1 Partial Recombinant Protein (H00029110-Q01). (Showing 1 - 6 of 6 FAQ).

  1. What is the exact sequence this TBK1 antibody recognizes?
    • The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
  2. I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
    • While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
  3. We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
    • Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
  4. Is there a smaller size of your TBK1 antibody?
    • This TBK1 antibody is offered in a smaller 0.025 mg size.
  5. Are there any publications where this TBK1 antibody was used in western blot for mouse?
    • This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
  6. Cant this TBK1 antibody be conjugated to PE for FLOW?
    • Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

Additional Array Products

Bioinformatics Tool for TBK1 Partial Recombinant Protein (H00029110-Q01)

Discover related pathways, diseases and genes to TBK1 Partial Recombinant Protein (H00029110-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBK1 Partial Recombinant Protein (H00029110-Q01)

Discover more about diseases related to TBK1 Partial Recombinant Protein (H00029110-Q01).
 

Pathways for TBK1 Partial Recombinant Protein (H00029110-Q01)

View related products by pathway.

PTMs for TBK1 Partial Recombinant Protein (H00029110-Q01)

Learn more about PTMs related to TBK1 Partial Recombinant Protein (H00029110-Q01).
 

Research Areas for TBK1 Partial Recombinant Protein (H00029110-Q01)

Find related products by research area.

Blogs on TBK1.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBK1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBK1