TBC1D20 Antibody

Images

 
Immunohistochemistry-Paraffin: TBC1D20 Antibody [NBP1-92478] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D20 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TBC1D20 Protein (NBP1-92478PEP)
Publications
Read Publication using NBP1-92478.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBC1D20 Antibody

  • C20orf140chromosome 20 open reading frame 140
  • dJ852M4.2
  • FLJ45119
  • TBC1 domain family member 20
  • TBC1 domain family, member 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55113
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
NBP2-20839
Species: Hu
Applications: WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
H00339122-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-98500
Species: Hu
Applications: WB
NBP1-54654
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-76350
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-97677
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-92478
Species: Hu
Applications: IHC, IHC-P

Publications for TBC1D20 Antibody (NBP1-92478)(1)

Reviews for TBC1D20 Antibody (NBP1-92478) (0)

There are no reviews for TBC1D20 Antibody (NBP1-92478). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TBC1D20 Antibody (NBP1-92478) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBC1D20 Products

Bioinformatics Tool for TBC1D20 Antibody (NBP1-92478)

Discover related pathways, diseases and genes to TBC1D20 Antibody (NBP1-92478). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D20 Antibody (NBP1-92478)

Discover more about diseases related to TBC1D20 Antibody (NBP1-92478).
 

Pathways for TBC1D20 Antibody (NBP1-92478)

View related products by pathway.

Blogs on TBC1D20

There are no specific blogs for TBC1D20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D20