Recombinant Human TAZ/WWTR1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related TAZ/WWTR1 Peptides and Proteins

Order Details


    • Catalog Number
      H00025937-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human TAZ/WWTR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 201-300 of Human WWTR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
WWTR1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAZ/WWTR1 Protein

  • FLJ27004
  • FLJ45718
  • TAZ
  • TAZDKFZp586I1419
  • transcriptional co-activator with PDZ-binding motif
  • Transcriptional coactivator with PDZ-binding motif
  • WW domain containing transcription regulator 1
  • WW domain-containing transcription regulator protein 1
  • WWTR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-86860
Species: Hu
Applications: WB, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-90187
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
H00154796-B01P
Species: Hu, Rt
Applications: WB, ELISA
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-42378
Species: Hu
Applications: WB, IHC

Publications for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01) (0)

There are no publications for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01) (0)

There are no reviews for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01). (Showing 1 - 1 of 1 FAQ).

  1. I want to know which TAZ primary antibody is best produced for WB (human and mouse)!
    • I would recommend this TAZ antibody: NB110-58359. This is also comes in a sample size.

Additional TAZ/WWTR1 Products

Bioinformatics Tool for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01)

Discover related pathways, diseases and genes to TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01)

Discover more about diseases related to TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01).
 

Pathways for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01)

View related products by pathway.

PTMs for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01)

Learn more about PTMs related to TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01).
 

Research Areas for TAZ/WWTR1 Partial Recombinant Protein (H00025937-Q01)

Find related products by research area.

Blogs on TAZ/WWTR1

There are no specific blogs for TAZ/WWTR1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAZ/WWTR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WWTR1
Entrez