TATDN2 Antibody

Images

 
Western Blot: TATDN2 Antibody [NBP1-93652] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: TATDN2 Antibody [NBP1-93652] - Staining of human breast shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TATDN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSRSRMSDYSPNSTGSVQNTSRDMEASEEGWSQNSRSFRFSRSSEEREVKEKRTFQEEMPPRPCGGHASSSLPKSH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TATDN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TATDN2 Protein (NBP1-93652PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TATDN2 Antibody

  • KIAA0218
  • MGC126819
  • MGC126825
  • putative deoxyribonuclease TATDN2
  • TatD DNase domain containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8200
Species: Hu, Mu
Applications: IHC
MAB8200
Species: Hu, Mu
Applications: IHC
MAB90551
Species: Hu, Mu, Rt
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-15079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NBP2-33583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85299
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-93652
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TATDN2 Antibody (NBP1-93652) (0)

There are no publications for TATDN2 Antibody (NBP1-93652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TATDN2 Antibody (NBP1-93652) (0)

There are no reviews for TATDN2 Antibody (NBP1-93652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TATDN2 Antibody (NBP1-93652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TATDN2 Products

Bioinformatics Tool for TATDN2 Antibody (NBP1-93652)

Discover related pathways, diseases and genes to TATDN2 Antibody (NBP1-93652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TATDN2 Antibody (NBP1-93652)

Discover more about diseases related to TATDN2 Antibody (NBP1-93652).
 

Pathways for TATDN2 Antibody (NBP1-93652)

View related products by pathway.

Blogs on TATDN2

There are no specific blogs for TATDN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TATDN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TATDN2