Recombinant Human TAS2R38 Protein

Images

 
There are currently no images for TAS2R38 Recombinant Protein (H00005726-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Func

Order Details

Recombinant Human TAS2R38 Protein Summary

Description
An un-tagged recombinant protein corresponding to the amino acids 1-333 of Human TAS2R38 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCVAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TAS2R38

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAS2R38 Protein

  • PTCphenylthiocarbamide tasting
  • T2R38
  • T2R61PTC bitter taste receptor
  • taste receptor type 2 member 38
  • Taste receptor type 2 member 61
  • taste receptor, type 2, member 38

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: WB, IHC
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-58599
Species: Hu
Applications: ICC/IF
NB100-368
Species: Hu
Applications: WB
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
1705-HH/CF
Species: Hu, Mu

Publications for TAS2R38 Recombinant Protein (H00005726-G01) (0)

There are no publications for TAS2R38 Recombinant Protein (H00005726-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAS2R38 Recombinant Protein (H00005726-G01) (0)

There are no reviews for TAS2R38 Recombinant Protein (H00005726-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TAS2R38 Recombinant Protein (H00005726-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAS2R38 Products

Bioinformatics Tool for TAS2R38 Recombinant Protein (H00005726-G01)

Discover related pathways, diseases and genes to TAS2R38 Recombinant Protein (H00005726-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAS2R38 Recombinant Protein (H00005726-G01)

Discover more about diseases related to TAS2R38 Recombinant Protein (H00005726-G01).
 

Pathways for TAS2R38 Recombinant Protein (H00005726-G01)

View related products by pathway.

Research Areas for TAS2R38 Recombinant Protein (H00005726-G01)

Find related products by research area.

Blogs on TAS2R38

There are no specific blogs for TAS2R38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TAS2R38 Antibody
NBP2-33404
GLI-1 Antibody
NB600-600

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAS2R38 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAS2R38