TAS2R103 Antibody

Images

 
Western Blot: TAS2R103 Antibody [NBP3-10232] - Western blot analysis of TAS2R103 in Mouse Heart lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAS2R103 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse TAS2R103 (NP_444441.1). Peptide sequence WRHLKNMCHSATGSRDVSTVAHIKGLQTVVTFLLLYTAFVMSLLSESLNI
Clonality
Polyclonal
Host
Rabbit
Gene
Tas2r103
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for TAS2R103 Antibody

  • T2R23
  • TAS2R23
  • TRB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-55386
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56398
Species: Hu
Applications: ICC/IF, WB
H00050840-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00028951-M04
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP3-09892
Species: Hu
Applications: WB
NB110-74890
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89111
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
7268-CT
Species: Hu
Applications: BA
DPG00
Species: Hu
Applications: ELISA
AF5510
Species: Hu
Applications: WB
AF7550
Species: Hu
Applications: KO, WB
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP2-92895
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-06398
Species: Hu, Pm, Rt
Applications: IB, ICC/IF, IHC, IHC-P, WB
NBP3-10232
Species: Mu
Applications: WB

Publications for TAS2R103 Antibody (NBP3-10232) (0)

There are no publications for TAS2R103 Antibody (NBP3-10232).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAS2R103 Antibody (NBP3-10232) (0)

There are no reviews for TAS2R103 Antibody (NBP3-10232). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAS2R103 Antibody (NBP3-10232) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAS2R103 Products

Array NBP3-10232

Bioinformatics Tool for TAS2R103 Antibody (NBP3-10232)

Discover related pathways, diseases and genes to TAS2R103 Antibody (NBP3-10232). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TAS2R103

There are no specific blogs for TAS2R103, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAS2R103 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Tas2r103