We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TARBP1 Recombinant Protein Antigen

Images

 
There are currently no images for TARBP1 Protein (NBP1-86902PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TARBP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TARBP1.

Source: E. coli

Amino Acid Sequence: MNELNSVSDLDRCHLYLMVLTELINLHLKVGWKRGNPIWRVISLLKNASIQHLQEMDSGQEPTVGSQIQRVVSMAALAMVCEAIDQKPELQLDSLHAG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TARBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86902.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TARBP1 Recombinant Protein Antigen

  • EC 2.1.1.-
  • FLJ30482
  • TAR (HIV-1) RNA binding protein 1
  • TAR RNA loop binding protein
  • TAR RNA-binding protein 1
  • TAR RNA-binding protein of 185 kDa
  • tardbp1
  • TRM3probable methyltransferase TARBP1
  • TRP-185TAR (HIV) RNA binding protein 1
  • TRP185TAR (HIV) RNA-binding protein 1

Background

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. This element forms a stable stem-loop structure and can be bound by either the protein encoded by this gene or by RNA polymerase II. This protein may act to disengage RNA polymerase II from TAR during transcriptional elongation. Alternatively spliced transcripts of this gene may exist, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48860
Species: Hu
Applications: IHC,  IHC-P
NBP1-79286
Species: Rt
Applications: WB
NBP1-88376
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-38284
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NB100-87021
Species: Hu
Applications: IP, WB
H00008575-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
NBA1-19349
Species: Mu
Applications: Flow, ICC/IF, In vitro, In vivo
235-F4
Species: Hu
Applications: BA
NBP3-16753
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
H00005725-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Single-Cell Western, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
NBP1-49535
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for TARBP1 Protein (NBP1-86902PEP) (0)

There are no publications for TARBP1 Protein (NBP1-86902PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TARBP1 Protein (NBP1-86902PEP) (0)

There are no reviews for TARBP1 Protein (NBP1-86902PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TARBP1 Protein (NBP1-86902PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TARBP1 Products

Array NBP1-86902PEP

Blogs on TARBP1

There are no specific blogs for TARBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TARBP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TARBP1