Talin1 Antibody (4G4)

Images

 
Immunocytochemistry/ Immunofluorescence: Talin1 Antibody (4G4) [H00007094-M21] - Analysis of monoclonal antibody to TLN1 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4G4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Talin1 Antibody (4G4) Summary

Immunogen
TLN1 (AAH42923 1324 a.a. - 1424 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGD
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TLN1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Talin1 Antibody (4G4)

  • ILWEQ
  • KIAA1027
  • talin 1
  • Talin1
  • talin-1
  • TLN
  • TLN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1173
Species: Mu, Rt
Applications: WB, IHC
AF4738
Species: Hu
Applications: WB
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
796-IC
Species: Mu
NBP2-45641
Species: Hu
Applications: WB, IHC
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF7279
Species: Hu, Mu
Applications: WB, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC

Publications for Talin1 Antibody (H00007094-M21) (0)

There are no publications for Talin1 Antibody (H00007094-M21).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Talin1 Antibody (H00007094-M21) (0)

There are no reviews for Talin1 Antibody (H00007094-M21). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Talin1 Antibody (H00007094-M21) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Talin1 Products

Bioinformatics Tool for Talin1 Antibody (H00007094-M21)

Discover related pathways, diseases and genes to Talin1 Antibody (H00007094-M21). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Talin1 Antibody (H00007094-M21)

Discover more about diseases related to Talin1 Antibody (H00007094-M21).
 

Pathways for Talin1 Antibody (H00007094-M21)

View related products by pathway.

PTMs for Talin1 Antibody (H00007094-M21)

Learn more about PTMs related to Talin1 Antibody (H00007094-M21).
 

Research Areas for Talin1 Antibody (H00007094-M21)

Find related products by research area.

Blogs on Talin1

There are no specific blogs for Talin1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Talin1 Antibody (4G4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TLN1
Entrez
Uniprot