Tafazzin/TAZ Antibody (3C10) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Tafazzin/TAZ Primary Antibodies

Order Details


    • Catalog Number
      H00006901-M19PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Tafazzin/TAZ Antibody (3C10) [PerCP] Summary

Immunogen
TAZ (AAH11515, 1 a.a. - 262 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQPGR
Specificity
TAZ (3C10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TAZ
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tafazzin/TAZ Antibody (3C10) [PerCP]

  • BTHSEFE
  • cardiomyopathy, dilated 3A (X-linked)
  • CMD3A
  • EFE2FLJ27390
  • G4.5endocardial fibroelastosis 2
  • LVNCX
  • Protein G4.5
  • tafazzin
  • Taz1
  • XAP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
NB110-58359
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF

Publications for Tafazzin/TAZ Antibody (H00006901-M19PCP) (0)

There are no publications for Tafazzin/TAZ Antibody (H00006901-M19PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tafazzin/TAZ Antibody (H00006901-M19PCP) (0)

There are no reviews for Tafazzin/TAZ Antibody (H00006901-M19PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Tafazzin/TAZ Antibody (H00006901-M19PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tafazzin/TAZ Products

Bioinformatics Tool for Tafazzin/TAZ Antibody (H00006901-M19PCP)

Discover related pathways, diseases and genes to Tafazzin/TAZ Antibody (H00006901-M19PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tafazzin/TAZ Antibody (H00006901-M19PCP)

Discover more about diseases related to Tafazzin/TAZ Antibody (H00006901-M19PCP).
 

Pathways for Tafazzin/TAZ Antibody (H00006901-M19PCP)

View related products by pathway.

PTMs for Tafazzin/TAZ Antibody (H00006901-M19PCP)

Learn more about PTMs related to Tafazzin/TAZ Antibody (H00006901-M19PCP).
 

Research Areas for Tafazzin/TAZ Antibody (H00006901-M19PCP)

Find related products by research area.

Blogs on Tafazzin/TAZ

There are no specific blogs for Tafazzin/TAZ, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tafazzin/TAZ Antibody (3C10) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol TAZ