TAFA3/FAM19A3 Antibody

Images

 
Western Blot: FAM19A3 Antibody [NBP1-59502] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAFA3/FAM19A3 Antibody Summary

Immunogen
Synthetic peptides corresponding to FAM19A3(family with sequence similarity 19 (chemokine (C-C motif)-like), member A3) The peptide sequence was selected from the middle region of FAM19A3. Peptide sequence FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAA The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (93%), Zebrafish (92%), Rabbit (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM19A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FAM19A3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TAFA3/FAM19A3 Antibody

  • Chemokine-like protein TAFA-3
  • FAM19A3
  • family with sequence similarity 19 (chemokine (C-C motif)-like), member A3
  • MGC138473
  • TAFA3
  • TAFA-3

Background

FAM19A3 is a member of the TAFA family which is composed of five highly homologous small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5154
Species: Hu
Applications: WB, IHC, Neut
NBP1-28912
Species: Rt
Applications: WB, PEP-ELISA
NBP1-97493
Species: Hu, Mu, Rt, Eq, Fi, Rb
Applications: WB, EIA, IHC, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5148
Species: Hu, Mu, Rt
Applications: WB, Flow, CyTOF-ready

Publications for TAFA3/FAM19A3 Antibody (NBP1-59502) (0)

There are no publications for TAFA3/FAM19A3 Antibody (NBP1-59502).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAFA3/FAM19A3 Antibody (NBP1-59502) (0)

There are no reviews for TAFA3/FAM19A3 Antibody (NBP1-59502). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAFA3/FAM19A3 Antibody (NBP1-59502) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAFA3/FAM19A3 Products

Bioinformatics Tool for TAFA3/FAM19A3 Antibody (NBP1-59502)

Discover related pathways, diseases and genes to TAFA3/FAM19A3 Antibody (NBP1-59502). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TAFA3/FAM19A3

There are no specific blogs for TAFA3/FAM19A3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAFA3/FAM19A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM19A3
Uniprot