T Plastin Antibody

Images

 
Western Blot: T Plastin Antibody [NBP1-57604] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

T Plastin Antibody Summary

Immunogen
Synthetic peptides corresponding to PLS3(plastin 3 (T isoform)) The peptide sequence was selected from the middle region of PLS3. Peptide sequence RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PLS3 and was validated on Western blot.
Positive Control
T Plastin Lysate (NBP2-66065)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for T Plastin Antibody

  • plastin 3 (T isoform)
  • plastin 3
  • plastin-3
  • T plastin
  • T-plastinT fimbrin

Background

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-52866
Species: Hu, Mu
Applications: WB
NBP2-30592
Species: Hu
Applications: IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NBP1-91787
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-2307
Species: Hu
Applications: WB
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready

Publications for T Plastin Antibody (NBP1-57604) (0)

There are no publications for T Plastin Antibody (NBP1-57604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for T Plastin Antibody (NBP1-57604) (0)

There are no reviews for T Plastin Antibody (NBP1-57604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for T Plastin Antibody (NBP1-57604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for T Plastin Antibody (NBP1-57604)

Discover related pathways, diseases and genes to T Plastin Antibody (NBP1-57604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for T Plastin Antibody (NBP1-57604)

Discover more about diseases related to T Plastin Antibody (NBP1-57604).
 

Pathways for T Plastin Antibody (NBP1-57604)

View related products by pathway.

PTMs for T Plastin Antibody (NBP1-57604)

Learn more about PTMs related to T Plastin Antibody (NBP1-57604).

Blogs on T Plastin

There are no specific blogs for T Plastin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our T Plastin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLS3
Uniprot